hemflashcard

What is the coordinate for TSS_tra_16584216?

Please help me with part one questions 3,4,5 Thank you PDF link https://www.cusd80.com/cms/lib/AZ01001175/Centricity/Domain/8922/eofad.pdf

Need help

enetic Mutations: Mastery Test X E W C f2.app.edmentum.com/assessments-delivery/ua/mt/launch/49372087/858339845/aHR0cHM6Ly9mMi5hcHAUZWRtZW50dW0uY29tL2xlYXJuZXItdWkvc2Vjb25 mentum Learni... My Virtual Academ... 1 v Next → Genetic Mutations: Mastery Test 3 2022 Edmentum. All rights reserved O Type here to search F 1 F3 00 Order details - Walmart.com 4 Select the correct answer from each drop-down menu. The lac operon in E.coli regulates genes that code for enzymes required for breakdown of lactose. The lac operon is operon that is activated in the presence of F4 Z $ F5 OO % 5 € F6 E A X 6 O F7 8 Free Mind - YouTube & 7 glucose lactose sugar k V F8 SOUS * 8 F9 4X Reset F10 + Next acer F11 F12 Scr Lk - PrtSc SysRq + Pause Break v 67°F Sunny Del Ins Home ►/11 S

6/3043936/variants/3043936/take/9/ Use at least three anatomical terms to describe the location of the star on the figure below. Answer using 1 to 3 complete sentences. www 00000 Total Questions Answered Pegas 200 V JIN All Changes Saved Q 12 ☆ . Continu 4:09 9/26

Explain the C-value paradox.

Please help urgently thank you

QNO-2: Discuss herbarium techniques .

vclient.psonsvc.net/#/question/7a377747-fc73-49c1-8a0f-d949747f2105/1cb2bdeb-d647-4422-a833-50824ccb9eb7 Review - A Bookmark Washington, Saniyah heritance / 10 of 15 Sickle cell anemia is an autosomal recessive disorder. If each parent carries one sickle cell allele (Tt), what are the chances that their child will have sickle cell anemia? O A. no chance ов. one in four (25%) O C. two in four (50%) O D. three in four (75%)

Please answer all its not graded

Please do not give solution in image format thanku Human health can be influenced by many factors, including exposure to physical, chemical, biological, and radiological contaminants in the environment. Which stage of development is the most susceptible to adverse health effects due to a normal decline in functioning of major physiologic processes? Question 1 options:   A-Elderly   B-Adult women   C-infants   D-Adolescents

One of the causes of morbidity for the Zika Virus is Guillain-Barré Syndrome, an immune attack of nerve cells. One possible mechanism for this is the virus's interference with normal immune function. In HIV the virus uses the CD4 receptor to enter T-cells. To assess if this might be a possibility in Zika infections BLAST the CD4 Reference Sequence (NG 027688.1) against the Zika Virus (taxid:64320) choosing "blastn" under Program Selection (select all that apply): O None of the recovered sequences have identities of greater than 80%. O Multiple Zika virus isolates are observed to have E-values of less than 0.02. O High scoring BLAST hits are observed in Zika virus isolates from humans, mosquitoes, and monkeys. O The BLAST hits return a partial cds collected in Uganda in 1947 - isolate Uganda1947.

Explain the loss-of-function mutation ?

Please answer questions 1-3

What is dosage compensation? Give its importance.  explain please

Solve these questions please.

Can you please help with this question?

Please help me answer Part III- 1, 2, 3, 4 of this case study, Thank you, Heres a link to the PDF https://www.cusd80.com/cms/lib/AZ01001175/Centricity/Domain/8922/eofad.pdf

Below is a primary sequence alignment between the wild-type hemoglobin protein, and the hemoglobin mutant that causes sickle-cell anemia. Please look at the alignment and select the correct answer below. wt_hemoglobin: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 sickle_cell: MVHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 ****** *****************************************************  wt_hemoglobin: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 sickle_cell: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 ************************************************************ wt_hemoglobin: KEFTPPVQAAYQKVVAGVANALAHKYH 147 sickle_cell: KEFTPPVQAAYQKVVAGVANALAHKYH 147 Answers: A) The observed mutation is a negatively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold B) The observed mutation is a negatively charged to a polar amino acid. Such a change…

Please help with this assignment question

I Review Lesch-Nyhan syndrome (OMIM 300322) is a rare X-linked recessive disorder that produces severe mental retardation, spastic cerebral palsy, and self- mutilation. Part A What is the probability that the first son of a woman whose brother has Lesch-Nyhan syndrome will be affected? Express your answer as a fraction (example 1/16). Submit Request Answer Part B If the first son of the woman described in (a) is affected, what is the probability that her second son is affected? Express your answer as a fraction (example 1/16). Submit Request Answer

Could you please explain the pathophysiology of covid 19 and appropriate terminology associated with covid 19?

Define C-value paradox

(codominance worksheet q6) please answer this question for me

O 0/75 answered O 65 What is the enhancer element? Select an answer and submit. For keyboard navigation, use the up/down arrow keys to select an answer. a 1 3 B Save Unanswered

(codominance worksheet q5) please answer this question for me

936/variants/3043936/take/12/ Use at least three anatomical terms to describe the location of the star on the figure below. Answer using 1 to 3 complete sentences. ooooo estions Answered O t UN All Changes Saved < Q

Edugence - dugence.com/student/studentformative/ Online Tools Juan Bonilla Velasquez > Nimitz 20-21: CA Biology Pros G. Question 14 (2014 6E) Sickle-shaped red blood cells result from a mutation in the gene that codes for hemoglobin. This mutation results in sickle-cell anemia. A partial sequence of bases from a normal hemoglobin gene and a sequence that results in sickle-cell anemia are shown below. Normal hemoglobin: T-G-A-G-G-T-C-T-C-C-T-C Sickle-cell hemoglobin: T-G-A-G-G-T-C-A-C-C-T-C What type of mutation is depicted in the sequence? Answer Substitution G Insertion Deletion J Frameshift Question 14 Next Previors Kach B Technoloes inc2021 Edugence Sign out

personal/eenongen_my_tnstate_edu/_layouts/15/doc.aspx?sourcedoc={a6b083c9-a226-4c31... O Search (Option + Q) Review View Help Editing v A BI U Ov =<=v 三 v ... Question 13 Zinc finger nuclease is a Gene editing tool: which uses a site-specific endonucleases containing a DNA-cleavage domain and a modular DNA-binding domain RNA-guided endonucleases programmable nucleases Exonuclease Question 14 Which elements are required for DNA to behave as a chromosome in yeast cells: a centromere an autonomous replicating sequence two telomeres Antibiotic selection marker Question 15 A series of such clones where the insert of each clone partially overlaps that of its neighbors with no gaps is known as a Clone Contig DNA fingerprinting A tiling path Genome MacBook Pro

How we can treatment the Sickle cell anemia by using gene therapy?  Please draw at your own hands.

polonlinemi.instructure.com/courses/25527/assignments/4743471?module_item_id%3D9163916 Due Feb 19 by 11:59pm Polnts 10O Submitting an external tool A person has blood type B. What combination of alleles could she have to give her this blood type? Select all that apply. O i O AB O Pi « Previous

Help

give answer for 6 and 7  asap  dont copy

Ugy Final Exam - Biology Final Exam - RELAX! - K1 x+ A learning.k12.com/d21/le/enhancedSequenceViewer/1433017?url=https%3A%2F%2Fe02711f5-1353-40b6-af9b-3497ff846bd.sequences.api.b Apps KI2 K12.com KI2 OLS Login O My Info K12 Customer Supp. Class Connect O LogMeln123 KI2 Microsoft Office 365 xfinity | Portal ( Back to Content Biology Final Exam Time Limit: 2:00:00 Time Left:1:25:28 Nizyree Dotson: Attempt 2 Question 9 (1 point) Which of these processes is not a type of reproduction? 7. 8 Sexual 10 11 12 Asexual 13 14 15 O Mitosis Metabolism 16 17 18 Question 10 (1 point) E A X C V B N M