A peripheral protein, which is not integral to the cell membrane, is also called: a multi-pass transmembrane protein (like band 3.0 protein) a single-pass transmembrane protein (like glycophorin A) a monolayer-associated protein (like the COX-1 protein) a protein-attached protein (like cytochrome c) a lipid-linked protein (like the Ras protein)

Mild, non-ionic detergents (like Triton X-100, with polar but uncharged regions that do not denature proteins) would be required for separation of which of the following proteins from cell membranes? monolayer-associated proteins lipid-linked proteins transmembrane proteins integral proteins peripheral proteins

The trans-Golgi network is the site of multiple sorting processes as proteins and lipids exit the Golgi complex. Compare and contrast the sorting of proteins to lysosomes with the packaging of proteins into regulated secretory vesicles such as those containing insulin. Compare and contrast the sorting of proteins to the basolateral versus apical cell surfaces in MDCK cells and in hepatocytes.

1. You are working on identifying novel proteins associated with the plasma membrane and you isolate XYZ1. Protein sequencing shows XYZ1 is comprised of: MGASSCSELRSSAFALSERSDKSSAVLLIVLGVMAVGIYLLVTMVLIIGTSANRASGSKD SESMSTLECAAPNDSAA a. Based on the sequence. Do you predict this is a peripheral membrane protein or an integral membrane protein? (Hint: use the Hydropathy plot generator on Expasy using default settings to help answer this question.) b. You decide to conduct an experiment to further assess how the protein is connected to the PM. The experiment is conducted by either 1) treating intact cells with chymotrypsin, 2) by disrupting the plasma membrane such that chymotrypsin has access to both sides of the plasma membrane, or 3) by using detergents to remove all lipid bilayers and treating the proteins such that chymotrypsin will have access to -Chym. Cond. 1 - +Chym. Cond. 2 Cond. 3 the entire length of the protein. The treatments are run on an SDS-PAGE gel (together with an…

There is a long chain of amino acids with long sections that are mostly polar, alternating with long sections that are nonpolar. How would this chain be organized if it were destined to become a transmembrane protein? A cytoplasmic protein?