Asparagine and glutamine residues in proteins are deamidated in an aqueous solution to yield aspartate and glutamate, respectively, and ammonium. Proteins undergoing deamidation of one or more of their Asn or Gln groups have been detected by isoelectric focusing. Why would isoelectric focusing be effective in separating deamidated from non-deamidated protein? Compare the relative pI values of the deamidated and non-deamidated proteins.

Asparagine and glutamine residues in proteins are deamidated in an aqueous solution to yield aspartate and glutamate, respectively, and ammonium. Proteins undergoing deamidation of one or more of their Asn or Gln groups have been detected by isoelectric focusing. Why would isoelectric focusing be effective in separating deamidated from non-deamidated protein? Compare the relative pI values of the deamidated and non-deamidated proteins.

Organic Chemistry

8th Edition

ISBN:9781305580350

Author:William H. Brown, Brent L. Iverson, Eric Anslyn, Christopher S. Foote

Publisher:William H. Brown, Brent L. Iverson, Eric Anslyn, Christopher S. Foote

Chapter3: Stereoisomerism And Chirality

Section3.8: The Significance Of Chirality In The Biological World

Problem CQ: The amino acids cysteine and serine are shown. What are the Cahn-Ingold-Prelog stereochemical...

See similar textbooks

Similar questions

I did not understand soultion for the question.. The relationship between Affinity and Association & Dissociation Constant. Four proteins (A-D) all bind the same ligand (X), with different affinities. For protein A & B we know that they have a binding site for X with a Kd (dissociation constant) of 10⁻⁵and 10⁻⁸ M, respectively. For protein C and D we know that they have a binding site for ligand X with a Ka (association constant) of 10³and 10⁵M, respectively. Which protein has the highest affinity for ligand ? Explain your reasoning. How do you make them all in same constant so that values can be compared and the one with highest Ka or lowest Kd (Highest affinity in both cases) can be ruled out.
Relationship between Affinity and Association & Dissociation Constant. Four proteins (A-D) all bind the same ligand (X), with different affinities. For protein A & B we know that they have a binding site for X with a Kd (dissociation constant) of 10-5and 10-8M, respectively. For protein C and D we know that they have a binding site for ligand X with a Ka (association constant) of 103and 105M, respectively. Which protein has the highest affinity for ligand X? Explain your reasoning.
Hemoglobin A has a pI value of 5.6 whereas the variant hemoglobin M has an aspartate residue in place of the normal valine at position 85 of the alpha chain. What effect will this substitution have on the electrophoretic behavior of the protein at pH 7.0. (explain clearly the reason for your answer)
Two phenylalanine residues are separated by 1.0 nm in a polypeptide. Calculate the dispersion interaction (kJ×mol-1). (a = 1.0 ´ 10-29 m3) I = 500 kJ×mol-1 ( ) -0.204 ( ) -0.133 ( ) -0.0688 ( ) -0.0375 ( ) -0.0233
The -helical parts of myoglobin and other proteins stop whenever a proline residue is encountered in the chain. Why is proline never present in a protein helix?
Could someone explain what this is saying? I would like a better understanding. FIGURE D CPP32 (Caspase-3) protease activity. Aliquots of cell lysates (50μL) were incubated with an equal volume (50 μL) of the reactionbuffer and 5 μL of 7-amino-4-trifluoromethyl coumarin (AFCDEVD) for 1 hour at 37˚C (Clontech). The shift in fluorescenceemission of AFC-DEVD, on its proteolysis to free AFC by theprotease, was detected in a fluorometer, using a 400 nm excitationfilter and 505 nm emission filter.
Noncompetitive inhibition is a limiting case in which the effect of binding inhibitor has no effect on the affinity for the substrate and vice versa. Suggest what a Lineweaver– Burk plot would look like for an inhibitor that had a reaction scheme similar to the scheme below, but where binding inhibitor lowered the affinity of EI for the substrate.
Which is incorrect regarding ligand-protein binding reactions? Select one: Allosteric modulation can alter the affinity of the protein for the ligand. Phosphorylation of the protein is an example of covalent modulation. Allosteric modulation of the protein’s binding site occurs directly at the binding site itself. If two ligands can bind to the binding site of the protein, competition for binding will occur. Binding reactions are either electrical or hydrophobic in nature.
Why is glycine the only amino acid commonly observed in peptides inconformations with phi and psi values which are not restricted to the values in the Ramachandran plot below?
A protein consists of two types of peptide chains (A and B) with an unknown stoichiometry (AxBy). When you ran this protein directly on reversed phase-HPLC with UV monitor set at 280 nm, two peaks were resolved. Mass spec determined that the peaks represented Chain A and Chain B, respectively. The peak area is 500,000 for Peak A (Chain A) and 100,000 for Peak B (Chain B). The molecular masses of Chain A and Chain B are 25,000 and 5000, respectively. The extinction coefficients for Chain A and Chain B are 1 mL/mg.cm and 0.5 mL/mg.cm, respectively. Please calculate x/y.
The velocity v with which a protein moves through water under the influence of an electric field varied with values of pH in the range 3.0 < pH < 5.0 according to the expression v/(μm s−1) = a + b(pH) + c(pH)2 with a = 0.80, b = −4.0 × 10−3, and c = −5.0 × 10−2. Identify the isoelectric point of the protein.
The following sequence is part of a globular protein. Predict the secondarystructure in this region. ... RRPVVLMAACLRPVVFITYGDGGTYYHWYH ...