You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280mm? Select the best answer.

You could use absorbance at 280nm or colorimetric assays like the Bradford assay or bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for your experiment. Why might you choose to use a colorimetric method instead of absorbance at 280mm? Select the best answer.

Human Anatomy & Physiology (11th Edition)

11th Edition

ISBN:9780134580999

Author:Elaine N. Marieb, Katja N. Hoehn

Publisher:Elaine N. Marieb, Katja N. Hoehn

Chapter1: The Human Body: An Orientation

Section: Chapter Questions

Problem 1RQ: The correct sequence of levels forming the structural hierarchy is A. (a) organ, organ system,...

See similar textbooks

Related questions

Q: Why is it important that the standard curve you create in biological analyses with spectrophotometry…

A: The spectrophotometer is an instrument used to measure the amount of light absorbed after it is…

Q: To determine whether proteins interact with each other which two techniques might you use 1. Yeast…

A: Protein-protein interactions (PPIs) are highly-specific physical contacts that occur between two or…

Q: Why do we need compensation for multiple parameter fluorescence detection? And how does compensation…

Q: If you mix two unknown samples and repeat the Lowry assay, is the absorbance equivalent to the sum…

A: Lawry essay is used to determine the protein level in a solution as it shows a color change…

Q: If you want to run 5 μl of a PCR sample on an agarose gel, how much 6X loading dye would you prep…

A: In this question, we are given volume of PCR reaction that is 5 ul. The concentration of loading dye…

Q: Explain the process behind coulometry.

A: Coulometry is a method which is based on the measurement of the quantity of electricity which is…

Q: Imagine you are performing another transformation experiment and need to transfer 250 µL of LB into…

A: "Biotechnology" is the use of our knowledge of biological processes for the development of…

Q: Which of the chemical compounds below can be used to label DNA for flow cytometry?

A: DNA flow cytometry is a way to measure the amount of DNA in the cell. DNA flow cytometry is used to…

Q: In primer designing, which of the following statements is correct? a. Primers should be 18-24 bases…

A: Primer is a short synthetic oligonucleotide which is used in many molecular techniques from PCR to…

Q: What do the peaks on the output graph of the mass spectrometer correspond to when peptide…

A: Mass spectrometer(MS) is an instrument/tool used to measure the mass-to-charge ratio of molecules in…

Q: Which of the following is NOT used in an in situ hybridization experiment for visualizing DNA? (CSLŐ…

A: Nucleic acid hybridization: It is a fundamental tool in molecular biology used to identify the…

Q: In a COVID test, why is it necessary to swab all the way at the back of the nose and throat

A: The COVID-19 pandemic has currently affected the whole world and has claimed a huge number of lives.…

Q: You now redo the experiment but instead of an SDS gel you run a native gel followed by completing…

A: Western blotting is the technique of identification of a specific protein in a given sample.

Q: Why can we use drops instead of concentration to graph the data? What do we have to do…

A: concentration: (1) The quantity of a sub-component (particularly a solute) in a solution. (2) The…

Q: Can you perform spectrophotometric analysis without the following? a. Bradford dye b. Molecular…

A: Protein is a macronutrient that is vital for building bulk. It is usually found in creature items,…

Q: What is G-banding? O A) Most commonly used banding method B) Uses giemsa dye O C) Produces…

A: A chromosome contains the genetic material, it is present in the nucleus in condensed form.

Q: when measuring the purity of a DNA sample? Please select the single answer that is most correct.

A: An instrument called spectrophotometer is able to measure the absorbance of specific wavelength of…

Q: List all the components and explain their purpose in the reaction mixture used for the dideoxy DNA…

A: The method of evaluating the sequence of nucleotides (As, Ts, Cs, and Gs) in a portion of DNA is DNA…

Q: I have a 1.270 ug/uL dna stock, how would you dilute this to 50ng/nL in a single dilution step

A: Formula - 1 ug = 1000 ng Dilution = initial volume / final volume = final concentration / initial…

Q: when creating a transgenic animal Explain why you need to culture the E. coli bacteria on agar that…

A: Transgenic refers to the artificial introduction of one or even multiple DNA sequences from another…

Q: At what wavelengths should the absorbances be read to examine the purity of a DNA sample with a…

A: A spectrophotometer is a tool that measures the number of photons (light energy) absorbed after…

Q: How do you interpret Weil-Felix Test? What are the sources of errors of the Weil-Felix Test?

A: A test used in the screening and diagnosis of typhus and other rickettsial infections is Weil-Felix…

Q: A technique used to determine the tertiary structure of a protein is— high-performance liquid…

A: Proteins are macromolecules formed by amino acids. They are large size molecules, polymers of…

Q: What volume of water is needed to make the following primer stocks solutions? Primer 1. 25 nM…

A: DNA Replication is the process by which one double-stranded DNA molecules gets replicated to produce…

Q: Which of the following test can compare microbial communities over a period of time? a Protein…

A: Microbial communities are assemblages of microorganisms that share a living environment. The…

Q: After incubation, the plates appeared as below: Water EvaGreen Ethidium Bromide SYBR Green 1

A: Ames assay is a method is used to determine whether a chemical can function as mutagen or not by…

Q: what is the incident beam it is the beam of light that exits the sample it is the beam of light is…

A: Spectrophotometry is a technique used to measure light absorption or the amount of chemicals in a…

Q: In your forensic laboratory, you set up a reaction to digest DNA with restriction enzymes. The final…

A: In molecular cloning techniques like PCR and restriction cloning, restriction enzyme digestion is…

Q: three different colored threads were crisscrossed on a slide. the different colored threads were…

A: Depth of concentration to a large extent, the target is low. Each time you switch to higher power,…

Q: Which of the following is NOT a function of the loading buffer used in SDS-PAGE? A) It contains a…

A: SDS-PAGE (Sodium dodecyl-Polyacrylamide gel electrophoresis), is an analytical method used to…

Q: Using Bradford Assay, plot the standard curve and find the unknowns. Protein Concentration A595 of…

A: Standard curve A set of standards are put up in the Bradford assay procedure from protein sources…

Q: What is the difference between a random sample and a composite sample? When would each be used?

A: Sampling is the process of obtaining a small representative of a large population which can be…

Q: Which of the phi/psi angles would be violating a ramachandran plot? Select all that apply: Phi= 90;…

A: The Ramachandran plot is a plot of the torsional angles - phi (φ)and psi (ψ) - of the residues…

Q: what are ways you can run a PCR cycle in a single test tube? how would you adjust amplificons,…

A: Applications of PCR: For DNA fingerprinting, to identify an individual from blood or tissue left at…

Q: An enzyme assay of 2 mL of extract shows 7.3 U/mL and a biuret assay shows 4 mg/mL protein on the…

A: Purification fold of a protein is the specific activity of protein at any particular stage during…

Q: Which of the following types of data produce curves similar in shape to the graph? Select all that…

A: ANSWER 6. Osmotic fragility test It is the test that measures the resistance to hemolysis of RBC…

Q: What type of biochemical test is this? Which group of organisms did we use it to differentiate?…

A: Biochemical test for detection of bacteria.

Q: What is the relationship between fluorescence intensity of a spot and the amount of DNA in a sample…

A: DNA microarray is a collection of DNA sequences attached to a solid surface such as a glass slide…

Q: Please briefly explain what gel electrophoresis is and how it works to separate a mixed sample of…

A: Gel electrophoresis is a technique which is used to separate the molecules under the application of…

Q: What are the importance of accurate wavelength measurement in purified DNA sample? Explain why…

A: DNA can be extracted by using different protocols. Protocols of DNA isolation are modified according…

Q: Which of the following is true of the gel electrophoresis shown? A) the power source has not been…

A: Gel electrophoresis is a technique applied to separate fragments of DNA on the basis of their size…

Q: Why is it not necessary to dilute your protein samples with buffer in a bradford protein assay…

A: This assay is used to measure the concentration of protein.

Q: You have added 4 μl of a 5 μM stock primer to a 25 μl PCR reaction. What is the amount of primer in…

A: To determine the amount of water the lyophilized primer is added and simply multiplied the number of…

Q: When would you use Edman degradation method and mass spectrometry in protein sequencing experiment

A: Edman degradation is a process of purifying protein.During the process of purification, protein gets…

Q: Why are DNA samples that are to be separated by gel electrophoresis always loaded at the cathode end…

A: The method of electrophoresis is used to separate biomolecules based on particle charge, particle…

Q: In which reagent is extracted DNA suspended to put it in solution? O Sodium dodecyl sulfate (SDS) O…

A: Introduction DNA extraction is a method to isolate DNA in a biological sample, which is done by…

Q: What are some similarities and differences in Bradford assay and Nanodrop (to obtain direct…

A: Protein quantification assays and their benefits and setback.

Q: Would any of the above give a positive Lieberman-Burchard test? Explain your answer.

A: The endocrine system is a vital biological system that produces various hormones. These hormones…

Question

100%

1) You are studying the toxic protein called ectatomin, a major component of ant venom
(specifically from the species Ectatomma tuberculatum), that embeds into cell
membranes and creates pores that cause cells to lyse. Ectatomin is a small dimer,
meaning the protein is comprised of two polypeptides; the sequences of the two
polypeptides are given in the table with single-letter abbreviations.
polypeptide sequences of ectatomin monomers
polypeptide
|protein sequence
polypeptide 1
GVIPKKIWETVCPTVEPWAKKCSGDIATYIKRECGKL
polypeptide 2
WSTIVKLTICPTLKSMAKKCEGSIATMIKKKCDK
You could use absorbance at 280nm or colorimetric assays like the Bradford assay or
bicinchoninic acid assay (BCA) assay to quantify the amount of ectatomin you have for
your experiment.
Why might you choose to use a colorimetric method instead of absorbance at 280nm?
Select the best answer.
a) Measuring absorbance at higher wavelengths, like 595nm or 562nm, is more accurate
than measuring absorbance at 280nm.
b) The Bradford and BCA assays require less time to setup and measure protein
concentration.
c) Ectotamin has few tryptophan and tyrosine residues, so the absorbance at 280nm will be
too low to accurately measure unless the sample is very concentrated.
d) The Coomassie dye or the bicinchoninic acid in the Bradford or BCA assay will react
with tryptophan and tyrosine residues to give a stronger absorbance reading, making it
easier to measure the concentration of samples with low amounts of protein.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

What is the expected molecular weight of the protein encoded by the sequence provided here: ATGGCGCACGCTGGGAGAACAGGGTACGATAACCGGGAGATAGTGATGAAGTACATCCATTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGGCGCCGCGCCCCCGGGGGCCGCCCCCGCACCGGGCATCTTCTCCTCCCAGCCCGGGCACACGCCCCATCCAGCCGCATCCCGGGACCCGGTCGCCAGGACCTCGCCGCTGCAGACCCCGGCTGCCCCCGGCGCCGCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCCACCTGACCCTCCGCCAGGCCGGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTCCAGCCAGCTGCACCTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGAGCTCTTCAGGGACGGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGTCATGTGTGTGGAGAGCGTCAACCGGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTGGATGACTGAGTACCTGAACCGGCACCTGCACACCTGGATCCAGGATAACGGAGGCTGGGTAGGTGCACTTGGTGATGTGAGTCTGGGCTGA
For the trinucleotide 5’ G-C-A-3’ How many nucleotide subunits are present in its ‘backbone’? How many nucleotide ‘non-backbone’ subunits are present? How many phosphodiester linkages are present? What is the overall charge carried by the trinucleotide?
. Disulfide bonds have been shown to stabilize proteins (i.e., make them less likely to unfold). Consider the cases shown schematically below for two variants of the same protein. In case #1 the disulfide forms between Cys residues that have been introduced near the protein N- and C-termini, and in case #2 the disulfide forms between Cys residues that have been introduced in the middle of the protein sequence. Which protein is likely to be more stable? (Note: Assume the disulfide bond is intact in both the unfolded and folded states). Explain your reasoning.
What are the sequences of all the possible tripeptides that contain the amino acids aspartic acid, leucine, and phenylalanine? Use the threeletter abbreviations to express your answer.
Lactose permease, a protein of E. coli, is composed of a singlepolypeptide that is 417 amino acids in length. By convention, theamino acids within a polypeptide are numbered from the aminoterminalend to the carboxyl-terminal end. Are the following questionsabout lactose permease true or false?A. Because the sixty-fourth amino acid is glycine and the sixty- eighth amino acid is aspartic acid, the codon for glycine,64, is closer to the 3′ end of the mRNA than the codon for aspartic acid, 68.B. The mRNA that encodes lactose permease must be greater than1241 nucleotides in length.
A common strategy for identifying distantly relatedhomologous proteins is to search the database using a shortsignature sequence indicative of the particular proteinfunction. Why is it better to search with a short sequencethan with a long sequence? Do you not have more chancesfor a “hit” in the database with a long sequence?
Given the fragment Ala-Lys-Tyr-Gly-Phe and Leu-Val-Ser-His-Cys-Arg, what is the expected result in both fragments with CuSO4 and NaOH? a. dark violet solution b. light violet solution c. blue solution d. colorless solution
As an example, consider albumin, a protein made of a single polypeptide weighing 66,000 daltons (66 kDa). On the other hand, gamma globulin has quaternary structure: is made of four polypeptides, two of which weigh 23,000 daltons (23 kDa) each, and two of which weigh 53,000 daltons (53 kDa) each. When treated with reducing agent and SDS, the subunits separate and they all linearize. If albumin and gamma globulin were run through gel electrophoresis, which polypeptides would move the fastest? Which would move the slowest?
For the m-RNA nucleotide codons given below, what is the corresponding sequence of amino acids? AUG UGU AUA UAU GUA AUC ACC UUC UAU GUA ACA UUU UGG AAC AGC UGC CAU GUA UAC CAG AAA CUU GCA GAG CUG GCU UUG AUA UGA The α-helices are known to contain primarily the amino acids methionine, alanine, leucine, glutamate, and lysine, while β-pleated sheets are known to primarily contain the amino acids tryptophan, tyrosine, phenylalanine, isoleucine, valine, and threonine. Which one of these two types of secondary protein structure is present with this amino acid sequence?
Shown below is a portion of a DNA sequence ( 31 base pairs long ) that encodes the last amino acids of a protein : The first three underlined base pairs indicate the frame and include the coding region . 123456789 A. Write the peptide sequence of the last 6 amino acids of the protein . Label both ends of the peptide . B. A insertion of one base pair causes the protein to decrease in length by 5 amino acids . With respect to the sequence given above , where does this insertion occur , and what base pair will you insert ? C. An change of one base pair leads to the protein to increase in length by one amino acid. With respect to the sequence given above , which base pair would you change ? How would you change this base pair for the protein to increase in length by one amino acid ?
If guanine, found in the first base triplet, is removed, explain how this would affect the structure of the protein.
I have four amino acids: serine, histidine, alanine, and tyrosine. How many different primary structures are possible if every amino acid is used only once?