The correct definition of the codon should be determined. Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Question

Want to see more full solutions like this?

Answer 1

Question

Chapter 31, Problem 1P

Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Expert Solution & Answer

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Want to see more full solutions like this?

Subscribe now to access step-by-step solutions to millions of textbook problems written by subject matter experts!

Students have asked these similar questions

PLEASE ANSWER WHY? Some substitution mutation result in a malfunctioning protein but others do not. Why is this?

Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"

Structural Stability of DNA True or false Hydrophobic bonding between stacked purine and pyrimidine Hydrogen bonding between purine and pyrimidine bases Hydrogen bonding between adjacent pyrimidine bases tRNA True or false A given tRNA can be charged with only one particular amino acid The anticodon of tRNA finds the complementary codon on mRNA The amino acid is attached to end of tRNA The amino acid is recognized by the anticodon of tRNA

Answer 2

Question

Chapter 31, Problem 1P

Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Expert Solution & Answer

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Want to see more full solutions like this?

Subscribe now to access step-by-step solutions to millions of textbook problems written by subject matter experts!

Answer 3

Question

Chapter 31, Problem 1P

Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Expert Solution & Answer

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Want to see more full solutions like this?

Subscribe now to access step-by-step solutions to millions of textbook problems written by subject matter experts!

Answer 4

Question

Chapter 31, Problem 1P

Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Expert Solution & Answer

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Want to see more full solutions like this?

Subscribe now to access step-by-step solutions to millions of textbook problems written by subject matter experts!

Answer 5

Chapter 31, Problem 1P

Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Expert Solution & Answer

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Answer 6

Chapter 31, Problem 1P

Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Expert Solution & Answer

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Answer 7

Chapter 31, Problem 1P

Interpretation Introduction

Interpretation: The correct definition of the codon should be determined.

Concept Introduction: Protein synthesis (translation) is a process of generating new protein sequences inside the cell. This process takes place in the cytoplasm of the cell. This process is balanced by the degradation or export of cellular proteins. It is constituted of three steps, initiation, elongation, and termination.

Answer 8

Expert Solution & Answer

Answer to Problem 1P

Correct answer: Option (c), three nucleotides encode an amino acid.

Answer 9

Expert Solution & Answer

Answer 10

Expert Solution & Answer

Answer 11

Explanation of Solution

Reason for correct option:

Option (c) is three nucleotides encode an amino acid. A codon is a set of three nucleotides, that codes for an amino acid. An amino acid can have more than one codon. Hence, this option is correct.

Answer 12

Conclusion

Reasons for incorrect options:

Option (a) is an alternative name for a gene. A codon is not an alternative name of the gene. It is a set of three nucleotides that encode an amino acid. Hence, this option is incorrect.

Option (b) is three amino acids that encode a nucleotide. Amino acids do not encode nucleotide, but three nucleotides (a codon) encode an amino acid. Hence, this option is incorrect.

Option (d) is one of the three nucleotides that encode an amino acid. The group of all the three nucleotides encoding an amino acid is termed as the codon. Hence, this option is incorrect.

Answer 13

Ch. 31 - Prob. 1P Ch. 31 - Prob. 2P Ch. 31 - Prob. 3P Ch. 31 - Prob. 4P Ch. 31 - Prob. 5P Ch. 31 - Prob. 6P Ch. 31 - Prob. 7P Ch. 31 - Prob. 8P Ch. 31 - Prob. 9P Ch. 31 - Prob. 10P

Concept explainers

Videos

Answer to Problem 1P

Explanation of Solution

Want to see more full solutions like this?

Chapter 31 Solutions