Answered: compare and contrast the four in tables…

Science

Biology

compare and contrast the four in tables 1. active and passive transport

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter5: Membranes And Transport

Section: Chapter Questions

Problem 4TYK: A characteristic of carrier molecules in a primary active transport pump is that: a. they cannot...

See similar textbooks

Related questions

Q: Consider the MN blood system in humans. This blood system consists of only two alleles, M and N, and…

A: Co-dominance is a genetic phenomenon in which both alleles of a gene are expressed, meaning neither…

Q: Describe the evolution of each both E coli bacteria and the cactus, and if their food could affect…

A: Evolution is the process through which living beings change over time, allowing them to adapt to new…

Q: Include the normal/standard values and state whether increase or decrease in the values mark the…

A: Introduction:- Chronic Kidney Disease Stage 5 Secondary to Hypertensive Nephrosclerosis is…

Q: in the cloning vector, what would be the plausible impacts if a mutation at the Ori site renders it…

A: The origin of replication (ori) and all of its regulatory components make up the replicon. DNA…

Q: Does this patient have a thyroid disorder? If so, what would the most likely diagnosis. What further…

A: Whether the thyroid is generating too few or too many hormones determines the symptoms of a thyroid…

Q: Compare and contrast the receptor-binding proteins of the envelope and the receptor used by the…

A: SARS - COV- 2 stands for severe acute respiratory syndrome coronavirus virus 2. It is highly…

Q: Drosophila can have a yellow-brown body (wild-type [+]) or a black body [b] as a result of a…

A: Drosophila species are small flies & typically pale yellow to reddish brown to black, with red…

Q: can marijuana cause a car accidents and marijuana car accidents

A: Introduction Any substance that acts on the central nervous system and alters brain function…

Q: Which of the following substances are generally poor immunogens? 單選: A. Lipids B. Carbohydrates C.…

A: Immunogen is any type of foreign biological/chemical agents that can elicit immune response and…

Q: arguments on why marijuana should not be legalized

A: Marijuana also known as cannabis. it is psychotic drug derived cannabis plant usually fond in…

Q: 1.Differentiate the three phyla of Worms in terms of their body structure, habits and importance.…

A: Three phyla of Worms in terms of their body structure, habits and importance are as follows- 1.…

Q: FILL IN THE BLANKS 1. Examples of a fat soluble vitamin are …… , …….. And examples of water…

A: Biomolecules are the macro and micromolecules produced and secreted by biological cells. proteins,…

Q: 8. Which animals are the most closely related based on the chart below? Common name Bobcat Jaguar…

A: Animal kingdom is divided is one of the most advanced Kingdom. Organisms present are range from…

Q: In the following experiment, what is the Independent variable and Dependent Variable?

A: An independent variable is a changeable variable that may be utilized to determine its influence on…

Q: e a

A: Hemocytometer is a red blood cell counting chamber. It is used for quantifying red blood cells.

Q: ANswer the questions related to animal nutrition: a. In poultry feed formulation, why is the ME…

A: a.In animal husbandry poultry farming mainly raises domesticated birds such as…

Q: 2. Examine the pedigree chart shown below. For each individual, write the genotype in the square or…

A: In order to determine how a given trait is passed down through a family, pedigrees are employed as a…

Q: A steady increase in the excretion of sodium and chlorine ions causes the insufficiency of one…

A: Introduction:- Hormones are the chemical messengers which are released by endocrine glands, directly…

Q: The gene for red-green color blindness is recessive and X-linked. What will be the expected…

A: Human eyes are capable of detecting three colours: red, green, and blue. These colours are…

Q: The primary structure of DNA is held together with ___________ bonds, and the secondary structure is…

A: Linear nucleotide sequences joined by powerful phosphodiester bonds are referred to as the primary…

Q: 1 2 3 Choose 2 correct answers. The cranio-caudal and lateral folding of the embryo 1. Enlarges the…

A: Understanding the processes of development can help us understand how different organisms evolved…

Q: Antispychotics are available as Long acting (depot) injections?

A: Antipsychotics are a group of psychotropic drugs that are mostly used to treat psychosis, which…

Q: You discover a new species of poison-dart frog which secretes a neurotoxin in the skin mucous with…

A: We need to figure out how the neurotoxic released by a new species of poison-dart frog works.…

Q: How is Bacterial DNA structure similar or different with Fungal DNA structure? Please provide a…

A: Bacteria and fungi may seem very different, but they do share some characteristics at the molecular…

Q: Compute for the prevalence of CHD by age group. Age Group 30-39 40-49 50-59 TOTAL Population 1,869…

A: Coronary heart disease (CHD) is a type of cardiovascular disease caused by the narrowing of the…

Q: Discuss about reabsorption of sodium and reabsorption of sodium in the kidney. Explain the flow or…

A: ANSWER) Reabsorption of sodium is the backward movement of the water from the tubules to the plasma…

Q: Hyperprolactinemia is an adverse effect of conventional antipsychotic medications. All of the…

A: Prolactin is a peptide hormone synthesized and released by the anterior pituitary (adenohypophysis).…

Q: The species to which modern people belong is Homo sapiens. What distinguishes Homo sapiens from…

A: Homo sapiens are evolved in africa 300,000 years ago due to the drastic climate change. The main…

Q: Concentration (mg/dL) Analysis: Countercurrent Flow II 80 40 90 (64) Concentration of Urea in Filter…

A: INTRODUCTION A phenomenon known as countercurrent flow which occurs in nature and is imitated in…

Q: A decrease in blood water levels is detected in the brain. The brain sends signals to the pituitary…

A: In this question, a process is explained and it has to be correctly identified. First of all, let us…

Q: Describe how a nerve impulse initiates muscle contraction

A: Movement is caused by muscles that are connected to bones. Muscle contraction can be considered the…

Q: Aging can be caused by Question 12 options: a) the damage caused by free radicals. b)…

A: Aging is a natural process for every living organism. This process is a time-related degradation…

Q: What is proprioception? What cues are important in spatial orientation? What features are associated…

A: In order to generate enough muscular activity to maintain a regulated, upright posture, our central…

Q: Using the genetic code table provided below, identify the open reading frame in this mRNA sequence,…

Q: Explain the concept of reproductive value and its significance in the evolution of life histories.

A: Reproductive value (RV) is a concept in evolutionary biology that refers to the expected…

Q: what marijuana can do to a person's mind, body, and health

A: Marijuana is a psychoactive drug produced by the Cannabis plant. It is mainly used for the…

Q: Describe the structure and functions of mammalian blood

A: Blood is a connective tissue and average human being contains about 5.5 l of blood in his body. 55…

Q: Describe various factors that affect plant growth (e.g. growth regulators, sunlight, nutrients,…

A: For growth and development, plants need light, water, oxygen, minerals, and other nutrients. In…

Q: C3 Photosynthesis C3 Photosynthesis 861 C4 Photosynthesis CAM Pathway 18 691 HO

A: Photosynthesis is a redox reaction where the carbon dioxide is reduced in the presence of sunlight,…

Q: How can site-specific recombination be used in recombinant DNA technology? Explain with an example

A: DNA manipulation is an important aspect of many biotechnology applications because it allows…

Q: “In the early Drosophila embryo, the establishment of different body region or tissues along, on the…

A: Drosophila species are small flies, typically pale yellow to reddish brown to black, with red eyes.…

Q: What types of interferons are activated by viruses at the earliest stages of infection?

A: Often microbes attack our body and diseases may be caused whenever the immunity becomes weak

Q: How can site-specific recombination be used in recombinant DNA technology

A: Recombinant DNA technology or rDNA technology deals with the manipulation of the genome of an…

Q: FILL IN THE BLANK (and state whether active or inactive.) The bolus is passing from the ………. To the…

A: Digestion is the process by which food is broken down into smaller molecules that can be absorbed…

Q: How does a bacterial dna look like? Please provide a drawing/picture

A: Bacteria are prokaryotic single-celled organisms. True nuclei and cell organelles that are bound to…

Q: Are there more species of large or small animals?

A: In general finding it suggests that there are more number of smaller species than larger.

Q: What effect will a decreased heart rate have on blood pressure?• What relationship will water volume…

A: Blood pressure is a measurement of the power used by your heart to circulate blood throughout your…

Q: In your own words explain endomysium and its function

A: Tissue is a group of cells that have a common origin and functions together to form specialised…

Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…

A: Peptide 1 is migrate most slowly during size exclusion chromatography

Q: Using the genetic code table provided below, write out the sequence of three different possible mRNA…

A: Codons, which are groups of three nucleotides, are read by cells to decode mRNA. The majority of…

Concept explainers

Osmosis

In simple words, osmosis is the slow, gradual movement of a liquid through a membrane. But there are nuances to this process. For instance, there has to be an imbalance in the distribution of solute in the liquid on either side of the membrane, which has to be semipermeable. The liquid in the region with a lower solute concentration moves to the region with a higher concentration, thereby displacing the solution in the process. The objective is to equalize the concentration of molecules on both sides of the membrane; the displacement of liquid can be viewed as a byproduct of this equalization. Since there is no energy required to carry osmosis, it is considered a passive process.

Question

compare and contrast the four in tables

1. active and passive transport

2. action membrane potential and resting membrane potential

3. endocrine and exocrine glands

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

2. Circle the correct bolded blue word. a. A substance that moves across a membrane "down" or "with" their concentration gradient is moving from the side with a higher / lower concentration of that substance to the side with a higher / lower concentration. This does / doesn't require energy input and is called active / passive transport. b. A substance moving "against" or "up" its concentration gradient is moving from the side with a higher / lower concentration of that substance to the side with a higher / lower concentration. This does / doesn't require energy input and is called active / passive transport. c. If the energy from the hydrolysis of ATP is directly used to pump the substance, the transport is called primary /secondary active transport. d. Ion-coupled transport is primary /secondary active transport and has two parts. First, the hydrolysis of ATP is used to power the creation of an ion concentration gradient. The ion is typically Na* or H*. Second, the energy stored in…
Below are three statements - two of which are truths and one is a lie. Which of the following statements is a lie? Select one: a. Both primary and secondary transport moves solutes against their concentration gradients. b. The primary active transport prepares the conditions of the membrane gradient by making the extracellular membrane slightly more negative than the intracellular membrane. c. The primary active transport uses ATP while secondary active transport helps replenish ATP.
Name at least one similarity and at least one difference between the following (it may help to review the definitions of the terms using the glossary):A. Symport and antiportb. Active transport and passive transportC. Membrane potential and electrochemical gradientD. Pump and transporterE. Axon and telephone wireF. Solute and ion
The fluidity of the plasma membrane increases with 1.Increase in unsaturated fatty acids in the membrane 2.Increase in saturated fatty acids in the membrane 3.Increase in glycolipid content in the membrane 4.Increase in phospholipid content in the membrane
8. Define homeostasis. maintoining nterral balance 9. What role does the cell membrane play in maintaining homeostasis? 10. How is facilitated diffusion different from diffusion? How are they similar? 11. List two ways that active transport is different than passive transport. 1) 2) 12. Why is the sodium-potassium pump considered an active transport? Which direction are the sodium and potassium bing pumped? How many sodiums are being pumped? How many potassiums are being pumped?
When the nerves deliver a signal to contract, Ca++ (calcium ions) rush into the cell. The calcium ion influx causes specialized fibers to contract. Afterward, calcium ions are pumped out of the cell by calcium ATPases. What transport type(s) is occuring?s antiporter only ion gated transport followed by active transport active transport only ion gated transport only active transport followed by ion gated transport
Which of the following statements are correct? Explain your answers. The plasma membrane is highly impermeable to all charged molecules. Channels have specific binding pockets for the solute molecules they allow to pass. Transporters allow solutes to cross a membrane at much faster rates than do channels. Certain H+ pumps are fueled by light energy. The plasma membrane of many animal cells contains open K+ channels, yet the K+ concentration in the cytosol is much higher than outside the cell. A symport would function as an antiport if its orientation in the membrane were reversed (i.e., if the portion of the molecule normally exposed to the cytosol faced the outside of the cell instead). The membrane potential of an axon temporarily becomes more negative when an action potential excites it.
In Chapters 11 & 12, the following examples of membrane transport proteins are given. Fill out the table with the correct answer for that particular transport protein. Type of transport protein (channel or carrier/transporter?) K* leak channel glucose transporter bacteriorhodopsin Na-K pump glucose-Na symport Na-H exchanger Performs active or passive transport? Energy source for movement of solute(s) or ion(s) Direction of movement of solute(s) or ion(s) with respect to the electrochemical gradient Na K* Na glucose Na H' Direction of movement of solute(s) or ion(s) with respect to the membrane crossed Na K₁ Na' glucose Na H' Is the protein a uniport, symport, antiport, or none of the above?
Which of the following Ca++ ion channels removes calcium ions from the cytoplasm of the cell? 1. voltage-gated Ca++ channels 2. Na+/Ca++ active transport pumps 3. Ca++ uniporter 4. Na+/Ca++ exchanger Group of answer choices (A) 1 and 2 (B) 1, 2, and 3 (C) 2 and 4 (D) 2, 3, and 4 (E) 3 and 4
Types of transport based on energy: 1. Simple diffusion: 2. Facilitated diffusion or passive transport: 3. Active transport Types of transport based on membrane transport proteins: 1. Channels vs transporter/pumps
Below are three statements - two of which are truths and one is a lie. Which of the following statements is a lie? Select one: a.The primary active transport uses external chemical energy. b.The sodium-potassium pump which is an example of primary active transport is considered as the most important pump. c. In primary active transport, the energy is derived secondarily from energy that has been stored in the form of ionic concentration differences between the two sides of a membrane.
Which of the following statements about active processes of membrane transport is true? cellular energy is required substances move against its concentration gradient all requires the aid of proteins during transport a and b a, b, and c