generated from this gene. Be sure to appropriately label the ends of the molecule. 5'-ATGCACGGCGACTAG-3' For the toolbar, press ALT+F10 (PC) or ALT+FN+F10 (Mac). B I U Ꭶ Paragraph Arial 10pt E Ev Av AV I %0 F Q
Q: 4. Natural selection would reduce the variation in neck length in a population of giraffes. True O…
A: Natural selection is the process in which the living organisms in a population adapt to changes. The…
Q: 7. List pathways of lipid metabolism activated in adipose tissue after meal. Explain.
A: After a meal, elevated glucose levels cause the pancreas to secrete insulin. Increases in anabolic…
Q: 3. Type of Transport: Reasoning: Balanced Concentration (Equilibrium) Describe the cell membrane as…
A: Type of transport : Osmosis Reason: Osmosis is a type of transport system for subsatnces through…
Q: 23. If a fly acclimated more slowly than the change in air temperature, it would pay an opportunity…
A: Acclimation is a process of adaptation in a narrow sense. Flies that rapidly acclimitize to the…
Q: The next set of questions are all related to the following operon: This figure represents the ABC…
A: Introduction:- An operon is the unit of gene expression and regulation. It consists of promoter…
Q: 5. A man who is not bald married a non bald female whose mother is bald. A. What is the chance that…
A: Introduction:- Traits are the phenotypic expression of genotypic constituent of an individual.…
Q: Question: A tortoiseshell and calico cat are both heterozygous at the sex-linked orange locus…
A: Inheritance pattern is a type of pattern which determines how traits are passed on from parental to…
Q: what did darwin find when he went to falkland island in his journey? what tools did he find? how…
A: Since this question contains multiple subparts, only the first 3 (Three) parts will be answered , as…
Q: (b) Describe how Helicobacter pylori colonize and cause infection in the stomach.
A: Helicobacter pylori is a bacteria that can infect both the stomach and duodenum. The infection and…
Q: Why should bacterial culture plates be incubated inverted (bottom up)?
A: Microbial isolation is a process done in microbiology lab in order to obtained microbe of interest…
Q: Why is a metal loop heat to read before picking up a bacterial sample? What should you do with a…
A: In microbiology, inoculation is the technique of transferring bacteria into culture media so that…
Q: 19. Fish with Hb-1 likely occur in warmer waters than fish with Hb-2. True O False
A: Introduction : In low temperatures with typical environmental conditions, fish with the Hb-2…
Q: What are the main pathogens that cause pneumonia? detail explanation give every pathogen which…
A: An illness called pneumonia causes the air sacs in one or both lungs to become inflamed. The air…
Q: (b) Give two characteristics of Mycobacterium tuberculosis.
A: Mycobacterium tuberculosis(M. tb) is defined as a type of pathogenic bacterial species classified…
Q: Match the following statements to the type of gene they describe. ✓Encode proteins that promote cell…
A: Tumor supressor genes are those whose deletion or under expression may cause cancer. They include…
Q: What are the common three most important environmental considerations for the production,…
A: As the human population grows, so does the influence of humans on the environment. Humans frequently…
Q: A) A husband and wife have four daughters. What is the probability that their fifth child will also…
A: The sex of an organism allows the mixing of various genes, evolution, etc. In humans, sex is…
Q: In the lac operon (below), how will expression of the genes lacZ and lacy be effect by a mutation in…
A: Lac operon includes the genes that code for the enzymes involved in the catabolism of lactose sugar.…
Q: Affect relationship of mother organisms behaving in a way that increases the probability that they…
A: Reproductive isolation can be either prezygotic (barriers that prevent fertilization ) or…
Q: What is Post-Transcriptional Control, and why is it Important? Give an example, and explain the…
A: Post-transcriptional modification refers to the processing that occurs after an RNA molecule has…
Q: 2) A scientist wants to increase the amount of sample of a DNA sequence of 100 bps. Calculate the…
A: Given that molar mass of average DNA base pair is 600g/mol. That means 600g of base pairs contain…
Q: The bacterium Agrobacterium infects plants and causes plant cells to develop tumorlike cellular…
A: Antibiotics have definitely transformed the lives of countless individuals by rescuing them from…
Q: 1 a. explain briefly, Insects and freshwater fish are both categorized as animals. Describe how the…
A: 1 a. The respiratory system's principal job is to eliminate carbon dioxide and give oxygen to the…
Q: 6. In two or three sentences, describe how scientists identified these genes. 7. Why do you think it…
A: Suppose a gene alteration raises the chance of high blood pressure, but no one knows where that gene…
Q: 2) The intermediate disturbance hypothesis proposes that __________. A. the highest diversity in…
A: Introduction: The number of various species present in an environment and the relative abundance of…
Q: Which type of anxiolytic medication operates on GABA receptors to inhibit ANS activation, but comes…
A: Anxiolytics medications are the medications which is used to treat or for prevention of anxiety…
Q: 11 del 154 Chapter 13 smo ad plo odtone gibier Telow and ? QUESTION Kaylee Kauff EXERCISE #3 "Genes…
A: Gene regulation is defined as the process used to control the location, timing and the amount in…
Q: talk about the significant things that happened to darwin in his trip to falkland island, like what…
A: Charles Darwin visited the Falkland Island twice and during the time period of 1 March - 6 April…
Q: What are the steps involved in proper hand washing?
A: Advantages of hand washing: 1. Prevents the Spread of Disease: One of the most important advantages…
Q: The cell bodies of neurons controlling your feet are actually located in your spine. The cell body…
A: Neurons are the cells of the nervous system. These cells conduct the electrical nerve impulses to…
Q: The lactose operon is likely to be transcribed when _____. A) there is more glucose in the cell than…
A: The initiation of transcription determines the regulation of prokaryotic genes. The regulation of…
Q: Love the One You're With There are six known species of lizard that can reproduce both sexually and…
A: The organism's or an environmental group's atmosphere is the combination of physical, biological,…
Q: Use your knowledge of population growth models to evaluate the spread of Covid-19 in the world…
A: Depending on particular environmental factors, two different patterns of population expansion may…
Q: For that same genotype: In the presence of molecule A, what functional structural proteins are…
A: Introduction Gene is a functional unit of DNA. It carries all the information of a organism. Gene…
Q: Which of the following statements is most directly described by the first law of thermodynamics? A B…
A: First law of thermodynamics is a kind of energy conservation law which states that energy can…
Q: What are the formulating ingredients used in nicotine chewing gum? Please answer at your own easy…
A: Nicotine chewing gum is used for the cessation of smoking habit. It helps to decrease the withdrawal…
Q: The following is a picture of Eosin Methylene Blue Agar. What does the growth on this plate…
A: INTRODUCTION Eosine methylene blue agar Used for the isolation of gram negative bacteria Toxic…
Q: Pls help sorry for the trouble. Explain the mechanism that enables a local anesthetic to work and…
A: Mechanism of Action-Local anesthetics work to block nerve conduction by reducing the influx of…
Q: Climate change is becoming an ever-growing threat to human health and biology. Research an incident…
A: Introduction Long term pattern of weather in a region is called climate. Air temperature and…
Q: inducible operon
A: Transcription: The process of copying of a segment of DNA into RNA is known as Transcription. The…
Q: Please fill in UV-13: Tables A and B and use the Hardy-Weinberg Equations
A: Since the question contains multiple subparts, only the first three will be solved as per our…
Q: Different human individuals can be identified by comparing simple repeats. Come up with a comparison…
A: Biology terms are fundamental concepts and terms used in biology, which is the study of life and…
Q: Which of the following are found in eukaryotic cells but not in prokaryotic cells? A endoplasmic…
A: Prokaryotic cells are single-celled microorganisms that are thought to be the oldest on the planet.…
Q: Which of the following structural features of the DAPI molecule explain its binding to DNA at…
A: Introduction:- DNA acts as the genetic material and present inside the nucleus of a cell which is…
Q: 8. Populations of snapping shrimp from each side of the Isthmus can now be described as two separate…
A: The process of creating new species is called speciation. A species is a group of creatures that may…
Q: The famous ecologist Garrett Hardin argued that designated wilderness areas should not have…
A: People and Nature is an interdisciplinary textbook that examines the interconnections between…
Q: Silurian Rhudering nStage Ordovician Period Hirnantian Stage Rawtheya n Stage A. ascensus N.…
A: The data suggest that extinctions were brought on by climate change. This is believed to have had a…
Q: chrysanthemums in his greenhouse during the winter since the day length of winter was short.…
A: Chrysanthemum are short day plants which means they need longer period of continuous dark hours to…
Q: In the garden pea, yellow cotyledon color is dominant to green, and inflated pod shape is dominant…
A: x YC Yc yC yc YC YYCC Yellow inflated YYCc Yellow inflated YyCC Yellow inflated YyCc…
Step by step
Solved in 2 steps with 1 images
- The following is part of the non-template strand of DNA for a gene. 5'-TACTATCATGAGAGATAGGAG-3' Which of these sequences corresponds to the mRNA after transcription A)5'-AUGAUAGUACUCUCUAUCCUC-3' B) 5'-TACTATCATGAGAGATAGGAG-3' c) 5'-ATGATAGTACTCTCTATCCTC-3' d) 5'-UACUAUCAUGAGAGAUAGGAG-3' E) N-Tyr-Tyr-His-Glu-Thr-CA portion of the coding sequence of a cloned gene is shown here:5΄–GCCCCCGATCTACATCATTACGGCGAT–3΄3΄–CGGGGGCTAGATGTAGTAATGCCGCTA–5΄This portion of the gene encodes a polypeptide with the aminoacid sequence alanine–proline–aspartic acid–leucine–histidine–histidine–tyrosine–glycine–aspartic acid. Using the method ofsite- directed mutagenesis, a researcher wants to change the leucinecodon into an arginine codon, using an oligonucleotide that is19 nucleotides long. What is the sequence of the oligonucleotidethat should be used? Designate the 5′ and 3′ ends of the oligonucleotidein your answer. Note: The mismatch should be in the middleof the oligonucleotide, and a 1-base mismatch is preferableover a 2- or 3-base mismatch. Use the bottom strand as the templatestrand for this site-directed mutagenesis experiment.Based on the following wild type DNA sequence, indicate if each of the mutations should be classified as : insertion, deletion, missense, nonsense, silent (Use the provided Genetic Code table and remember you have been given DNA sequence). Wild Type: 5’ ATG GCT AGA GTC GAG TTG 3’ Mutant 1: 5’ ATG GCA GAG TCG AGT TG 3’ Mutant 2: 5’ ATG GCT TGA GTC GAG TTG 3’ Mutant 3: 5’ ATG GCT AGA GTT GAG TTG 3’ Mutant 4: 5’ ATG GCT AGA AGT CGA GTT G 3’ Mutant 5: 5’ ATG GCT AGA ATC GAG GTT 3’
- summarize these results using concise language in a neat table; Control : 5’ ATGTACGCGCGATCACCATACATCATGGCACCCGCTAGCTATTAACATGTTTTTT 3’ This is the coding strand of DNA and hence this DNA sequence is similar to mRNA sequence. So the mRNA sequence is : 5’ AUGUACGCGCGAUCACCAUACAUCAUGGCACCCGCUAGCUAUUAACAUGUUUUUU 3’ Mutant 1: 5’ ATGTACGAGCGATCACCATACATCATGGCACCCGCTAGCTATTAACATGTTTTTT 3’ mRNA sequence 5’ AUGUACGAGCGAUCACCAUACAUCAUGGCACCCGCUAGCUAUUAACAUGUUUUUU 3’ The bold Adenine is the mutated base which is substituted in place of Cytosine. So the codon change from GCG to GAG. GCG codes for Alanine but GAG codes for Glutamic acid. So the amino acid sequence changes. Hence this mutation is missense mutation where a base substitution results in change in amino acid sequence. Mutant 2: 5’ ATGTATGCGCGATCACCATACATCATGGCACCCGCTAGCTATTAACATGTTTTTT 3’ mRNA sequence: 5’ AUGUAUGCGCGAUCACCAUACAUCAUGGCACCCGCUAGCUAUUAACAUGUUUUUU 3’ In this mutation, Cytosine is replace by Thymine and hence the codon…Using the DNA nucleotide sequences for the wild-type and mutant genes in the following tables, determine the complementary mRNA sequence for the five portions of the Mc1r gene provided. (Note: You are only transcribing short portions of the DNA sequence for this protein. The actual gene contains 954 base pairs.) Using the mRNA sequence completed, determine the resulting amino acid sequence of the MC1R protein. (Note: You are translating only a portion of protein. The full protein is 317 amino acids long. The numbers above the columns in the tables indicate amino acid positions in the protein sequence.) You may use the genetic code chart providedWhich of the following set(s) of primers a–d couldyou use to amplify the following target DNA sequence, which is part of the last protein-coding exonof the CFTR gene?5′ GGCTAAGATCTGAATTTTCCGAG ... TTGGGCAATAATGTAGCGCCTT 3′3′ CCGATTCTAGACTTAAAAGGCTC ... AACCCGTTATTACATCGCGGAA 5′a. 5′ GGAAAATTCAGATCTTAG 3′;5′ TGGGCAATAATGTAGCGC 3′b. 5′ GCTAAGATCTGAATTTTC 3′;3′ ACCCGTTATTACATCGCG 5′c. 3′ GATTCTAGACTTAAAGGC 5′;3′ ACCCGTTATTACATCGCG 5′d. 5′ GCTAAGATCTGAATTTTC 3′;5′ TGGGCAATAATGTAGCGC 3′
- The code for a fully functional protein is actually coming from an mRNA transcript that has undergone post transcriptional processing which is essentially way too different from the original code in the DNA template. Given: Cytosine; a Protein with known amino acid sequence (amino acid sequence given below) MATIVNTKLGEHRGKKRVWLEGQKLLREGYYPGMKYDLELKDSQVVLRVKEEGKFTISKRERNGRVSPII DLTVQELATVFDGVEMLRVFIRNGAIVISAHHQQERVIERVNRLISKLENGESLSVCSLFHGGGVLDKAI HAGFHKAGIASAISVAVEMEGKYLDSSLANNPELWNEDSIVIESPIQAVNLSKRPPQVDVLMGGIPCTGA SKSGRSKNKLEFAESHEAAGAMFFNFLQFVEALNPAVVLIENVPEYQNTASMEVIRSVLSSLGYSLQERI LDGNEFGVIERRKRLCVVALSHGIDGFELEKVQPVRTKESRIQDILEPVPLDSERWKSFDYLAEKELRDK AAGKGFSRQLLTGDDEFCGTIGKDYAKCRSTEPFIVHPEQPELSRIFTPTEHCRVKGIPEELIQGLSDTI AHQILGQSVVFPAFEALALALGNSLWSWVGMMPIMVEVVDESQPVIGGEDFHWATALVDAKGTLKLSPAA KKQGMPFNIMDGQLAVYSPNGTKKSCGHEPCEYLPVMMSGDAIMVTSSLVH Requirement: Original DNA code (itemize the steps you would take to get to know the original DNA code of Cytosine in focus)Choose one of the strands and transcribe the strand. Show the steps (with proper label) and do a post-transcriptional processing. Once the transcript is made, do the process of translation. Again follow the steps. Use the Wobble Table for reference. DNA strand: 5'-TCGAAACGAGCTGCAGCTAGCTAGCTACGTCAGCTGCATCTGTCTACGAGCGACTGTCTAGCATAGCGTAGCTGC-3 'Complementary strand: 3'-TCGAAACGAGCTGCAGCTAGCTAGCTACGTCAGCTGCATCTGTCTACGAGCGACTGTCTAGCATAGCGTAGCTGC-5'Identify the open reading frame in the following DNA sequence, the protein that this gene encodes for, its function, and the source.…
- What restriction enzyme (or enzymes) would you use to cut the following... (Gene of Interest is Bolded) 1 tctagagtca tgaaacaaca aaaacggctt tacgcccgat tgctgacgct gttatttgcg 61 ctcatcttct tgctgcctca ttctgcagca gcggcggcaa atcttaatgg gacgctgatg 121 cagtattttg aatggtacat gcccaatgac ggccaacatt ggaagcgttt gcaaaacgac 181 tcggcatatt tggctgaaca cggtattact gccgtctgga ttcccccggc atataaggga 241 acgagccaag cggatgtggg ctacggtgct tacgaccttt atgatttagg ggagtttcat 301 caaaaaggga cggttcggac aaagtacggc acaaaaggag agctgcaatc tgcgatcaaa 361 agtcttcatt cccgcgacat taacgtttac ggggatgtgg tcatcaacca caaaggcggc 421 gctgatgcga ccgaagatgt aaccgcggtt gaagtcgatc ccgctgaccg caaccgcgta 481 atttcaggag aacacctaat taaagcctgg acacattttc attttccggg gcgcggcagc 541 acatacagcg attttaaatg gcattggtac cattttgacg gaaccgattg ggacgagtcc 601 cgaaagctga accgcatcta taagtttcaa ggaaaggctt gggattggga agtttccaat 661 gaaaacggca actatgatta tttgatgtat gccgacatcg attatgacca tcctgatgtc 721 gcagcagaaa ttaagagatg gggcacttgg tatgccaatg…Given the template DNA sequence: 3’ - TAC - CAG - GTT - ACC - ATC - 5’ A.) What will be the mRNA requence corresponding to the template DNA sequence? B.) What is the amino acid sequence in letter A? ( e.g. Arg, Phe, etc.) C.) If the coding sequence of the dsDNA will "serve" as the template for transcription, what is the corresponding mRNA sequence? D.) With the mRNA transcript in letter C, what will be the amino acid sequence? ( e.g. Arg, Phe, etc.)Shown below is a portion of a wild-type DNA sequence that encodes the last amino acids of a protein that is 270 amino acids long. The first three bolded base pairs indicate the frame and include the coding region. 5^ ...GCTAAGTATTGCTCAAGATTAGGATGATAAATAACTGG 3^ 3^.. CGATTCATAACGAGTTCTAATCCTACTATTTATTGACC 5^ Which strand is the template strand for transcription of this gene? Briefly explain how you know. An insertion of one base pair causes the protein to decrease in length by seven amino acids. With respect to the sequence given above, where does this insertion occur? A change of one base pair leads to the protein increasing in the length by one amino acid. With respect to the sequence given above, which base pair would you change, and what would you change this base pair for the protein to increase in the length by one amino acid?