List and describe the steps that make up the central dogma of molecular Biology. This means, how the molecular information moves through a cell... For the toolbar, press ALT+F10 (PC) or ALT+FN+F10 (Mac).
Q: What are the external factors on seedling growth? and what are their effects in seed growth and…
A: External factors and their effect on seedling growth and germination. 1. Water- there are enzymes…
Q: Synthesis: How does reproductive isolation differ in sympatric modes and allopatric modes of…
A: The reproductive isolation leads to the speciation that results in development of new species from…
Q: Human cells are highly resistant to transformation. Experiments have shown that 5 regulatory…
A: Proteins are the important macromolecules in the body that helps in functioning of varieties of…
Q: What are cell movements? How are these movements created?
A: The question is related to the movements of the cell and how these movements are performed by a…
Q: what is the present microorganism in soft swell spoilage?
A: Food spoilage refers to food that has been damaged orinjured that makes it undesirable for human…
Q: Which of the following enzymes adds methyl groups to the guanine on 5' end of the pre-MRNA? Methyl…
A: Option A (Methyl transferase) - They are a class of enzymes which are responsible for the transfer…
Q: Adeline, a 24-year-old graduate student presents to her Family Medicine Clinic for contraceptive…
A: The harmonal contraceptive method is most effective method to prevent pregnancy with less adverse…
Q: Describe the arrangement of floral members in relation to their insertion on thalamus?
A: The flowers are classified as hypognous, perigynous, or epigynous based on the position of the…
Q: uestion 27 In what way do crocodiles and alligators differ from the Lepidosaurs? O A) Four-chambered…
A: Permian extinction is a phenomenon where 95% of marine and 70% of terrestrial species went extinct.…
Q: Subconjunctival hemorrhage always causes red painful eye .A true .B false
A: A subconjunctival hemorrhage is a red spot on your eye caused by a broken blood vessel.look…
Q: Which of the following is a transversion mutation Select 4 correct answer(s) OA --> T OC--> T C -->…
A: Point mutations The mutations that occur at single base nucleotides are called a base or point…
Q: ררד חויתוידורידיד" The above image shows DNA during replication. The new DNA strand build using the…
A: Replication typically begins at a specific point on a dna sequence known as the replication origin.…
Q: The researcher above decides to test whether any gene functional classes or pathways are enriched…
A: INTRODUCTION Functional enrichment analysis, also known as pathway analysis, is quickly becoming one…
Q: What is the source of infection and mode of infection of the parasite?
A: Classification Kingdom : Animalia Phylum : Platyhelminthes…
Q: A diploid somatic ("body") cell has 2n=20 chromosomes. At the end of mitosis, each daughter cell…
A: * mitosis is a process in which chromosomes are separated into two new cells that gives rise to…
Q: Severe Combined Immunodeficiency (SCID) is X-linked Found only in females Both None
A: Severe combined immunodeficiency (SCID) is a genetic disorder of the immune system. Many genes…
Q: Proteins destined for secretion undergo folding into secondary and tertiary structures O a) once…
A: Protein secretion The organelle for the formation of a polypeptide is a Ribosome , Ribosomes are…
Q: What are the difficulties that you would face in classification of animals, if common fundamental…
A: The classification of living organisms is based on the consideration of fundamental characteristics…
Q: Explain why are urochordates classified "not true Chordates"? (minimum of 500 words)
A: Various scientist agreed that, at least 42000 species of vertebrates exist today and there have been…
Q: In Meselson and Radding modified Holliday model, following branch migration, what are the possible…
A: Meselson-Radding Model This is a model of genetic recombination. This model was formed to explain…
Q: 3. How does meiosis contribute to genetic diversity? 4. Why is tetrad formation important? 5. How…
A: 3. Meiosis recombines genes and creates new genetic variation by crossing over during pachytene…
Q: A protein is going to be associated with the cytosolic leaflet of the plasma membrane. This protein…
A: All cells are covered by an external membrane called plasma membrane which is also known as cellular…
Q: In which state, the sex chromosomes are present in a cell? O Euchromatin Heterochromatin Centromere…
A: Chromosomes are the thread like structure present in the nucleus of the cell.
Q: Checkpoint Factors Needed Duration CDK needed to materials/ (Present or molecules proceed with the…
A: The cell cycle involves the series of stages through which a cell undergoes when it grows and…
Q: staining
A: Staining- It is used to enhance contrast in samples, generally at the microscopic level. In other…
Q: Identify the variation of gametes from the genotype SS RR?
A: The variation of gametes is formed due to the law of independent assortment and through a process…
Q: Which of the following statements about tumor suppressor genes is FALSE? a) Inactivation of tumor…
A: False statement about tumor suppressor genes.
Q: What tests or diagnostic tools are done to diagnose Chlamydia trachomatis infection on the EYES?…
A: The basic clinical course of examination will be as follows:- History taking Examination…
Q: ASTIGMATISM usually causes HEADACHE .A true .B false
A:
Q: What is the function of: 1.Parenchyma 2.Islets of Langerhans 3. Septa
A: *Parenchyma is a plant cell type that acts as functional tissues in higher plants. These are group…
Q: A continuously growing population of bears has a population size of 500 and its intrinsic rate of…
A: Let us look at the given data - Initial Population size (N0) = 500 Intrinsic rate of increase (r) =…
Q: Illustrate the pathway of digestive enzymes in the pancreas.
A: The pancreas is a mixed gland that is it has both exocrine and endocrine parts in it which secretes…
Q: Human cells are highly resistant to transformation. Experiments have shown that 5 regulatory…
A: As per bartleby guidelines experts are allowed to answer only 1 question. Please post the other…
Q: In what cases would total length not be totally revealing about the length of a fish – can you think…
A: The length of the fish can be measured as follows: - Total length: - It is the length of the fish…
Q: 1. How may the following growth and culture conditions affect the length of the lag phase? EXPLAIN…
A: a) In case the inoculum is from an old culture than the lag phase will get extended. This is because…
Q: Why don't you heatfix a negative stain slide?
A: Negative staining is used to investigate the physical structure, size, and organization of…
Q: Osteocytes are bone cells. Collagen fibers and calcium salts are found in abundance between and…
A: Earlier osteoblasts that have become entrenched in the bone are known as osteocytes. Osteocytes are…
Q: If a cell has a chromosome number of 2 n=6, how many chromatids are expected to be present in…
A: Cell division is a type of splitting process which brings about division of parent cell into the new…
Q: Which of the following statements is/are true about steroids? Steroids ... a) are considered…
A: A steroid is an organic molecule that has four rings organised in a certain molecular arrangement…
Q: What is the Leaf Economic Spectrum in different taxa?
A: In biology, taxa can be defined as a group of on or more populations of an organism. This represents…
Q: Enumerate, describe and give the functions of all mechano receptors found in the skin. Identify if…
A: Our perceptions of signals within our bodies and of the world around us are mediated by a complex…
Q: Question 26 You find the following plant in the woods. What kind of plant is it? Angiotensin…
A: You find the following plants in the woods. What kind of plant is it?
Q: Helping tags: Biology, dilution, serial dilution, culture WILL UPVOTE, just pls help me answer the…
A: The cell density (N) is defined as the number of cells or channels per unit of cross-sectional area…
Q: Why is it essential to know the quality of the palay recieved from the farmers
A: * Palay means the rice which hasnt ben husked. Iloilo and ,Negros and Capiz were the areas that…
Q: Following the revised diagnosis at age 17, she received additional treatment. How does this…
A: These include the introduction of insulin analogs and the development of new ways to deliver…
Q: If you have otoliths from two fish of the same species and they are the same shape but different…
A: Otoliths reveal the ages of individual fish, almost like counting the rings in a tree. Knowing the…
Q: What are some biological examples in which lysosomic enzymes play a fundamental role?
A: A digesting enzyme-containing lysosome is a membrane-bound cell organelle. Lysosomes play a role in…
Q: Type of asexual reproduction: PARTHENOGENESIS TRANSVERSE FISSION BINARY FISSION BUDDING…
A: TYPES OF ASEXUAL REPRODUCTION DESCRIPTIONS TYPES OF ANIMAL/S…
Q: Calculate the rate of population change for a hypothetical population of wildebeest using the…
A: The growth of a population can be exponential or logistic depending upon availability of resources.…
Q: How do mitotic poisons like colchicines and hydroxyquinoline affect the the movement of chromosomes…
A: Mitotic positions They are referred to so as they inhibit the polymerisation of microtubules by…
![List and describe the steps that make up the central dogma of molecular Biology. This means, how the molecular information moves through a cell...
For the toolbar, press ALT+F10 (PC) or ALT+FN+F10 (Mac).
A v
Ix
...
BIUS
Paragraph
Arial
10pt
ABC
X O OQ
E = = E
x? X2
田田用困
<> Í {}
+]
図](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2F777811b0-9857-4611-b8ff-573db624e864%2F973e6e72-fc9d-4d59-85e4-6f2ef2a26524%2Fej5nfp_processed.jpeg&w=3840&q=75)
Trending now
This is a popular solution!
Step by step
Solved in 2 steps with 1 images
- Describe the main technique for amplifying a segment of DNA (like the one you suspect is involved in Lee’s cancer) from a complex mixture of genomic DNA. Remember that the entire human genome sequence is known. (Hint: This is a technique that is commonly used by laboratories that do genetic testing and various other applications of molecular biology.)Bioinformatics is an interdisciplinary field that integrates knowledge of computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (1) What does BLAST stand for? (ii) Explain the function of BLAST.Hi, I would like to know which program is used for the graphical presentation of the results of a meta-analysis of genome-wide linkage scans?
- The College of Medicine of the University of the USA - Texas offers a double degree program on medicine and molecular biology. Once you complete the requirements of the said program, you will graduate as a Medical Doctor and a Doctor Philosophy in molecular medicine (MD- PhD). Once of the requirements of the said program is to publish a dissertion on molecular medicine. Suppose you are on your final year under the said program, you will discuss one biomelecular disorder. You will then propose possible ways on addressing the said disorder.Describe one way of mapping the location of histones on the gencome. For the toolbar, press ALT+F10 (PC) or ALT+FN+F10 (Mac). BIU up Paragraph Arial 14px Pfueled.brightspace.com/d2l/le/enhancedSequenceViewer/3300467?url=https%3A%2F%2Ff59af8a9-95f5-419c-a486-a A rdschools.com bookmarks Drive Classes B Login Page Sign In Education and Lear... Content = 1.08 Unit Test: Gene Expression - Part 1 Which statement is most accurate? Hair is different from kidneys because the cells that make up hair and kidneys have different genes All cells have the same genes, but different genes are active in different cells. As cells and tissues differentiate, they produce new genes. All cells have the same genes, and all of a cell's genes are active at the same time. #m C $ J лае 1 2 3 4 5 & 7 8
- Original DNA Sequence: TACAC CTTGG CGACGACT... MRNA Sequence: Amino Acid Sequence: Mutated DNA Sequence #5 TACACCTT G G GACGACT... (Highlight the change) What's the mRNA sequence? What will be the amino acid sequence? Will there likely be effects? What type of mutation is this? 1. Which type of mutation is responsible for new variations of a trait? 2. Which type of mutation does not result in an abnormal amino acid sequence? 3. Which type of mutation stops the translation of an mRNA molecule? NOa) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSPRNA are extracted from liver cells and separated in agarose gel by electrophoresis side-by-side with a molecular weight marker. The separated RNA fragments are then transferred to an RNA-binding membrane. Next, this membrane is incubated with labelled probe specific for the gene X. This experiment determines: MOLECULAR BIOLOGY_basic how many copies of gene X there are in liver cells. if the gene X is translated in liver cells. if gene X has a point mutation in liver cells. the chromosomal location of gene X. the length of the transcript of gene X.
- Describe the 3 processes of central dogma of molecular biology. Share your thoughts on their significance in the transmission of traits(not more than 100 words).There is a hypothetical gene related to the nervous system of Drosophila. Describe all the methods, steps, and key substances you need to obtain to use the following techniques in experimental design to study the gene: - In situ hybridization (to find the mRNA) - Immunohistochemistry (to find the protein) - CRISPR-Cas9 (for loss of function) - Expression vector (for gain of function)Cap, EA1, and Sap are all genes/proteins of interest in this study. For each gene, what gene product is encoded and where is the gene (the literal DNA sequence) located physically in the cell? I need help fimiding this in the artticle and answer as short as possible https://www.ncbi.nlm.nih.gov/pmc/articles/PMC106848/