Normal Translocation chromosomes chromosomes Philadelphia chromosome 22 Direction bcry of bạr abl abl transcription Abnormal This translocation crossover results in the abnormal expression of a BCR/ABL fusion protein in white blood cells, thereby causing chronic myelogenous leukemia. FIGURE 25.13 The reciprocal translocation commonly found in people with chronic myelogenous leukemia. Genes-Traits In healthy individuals, the abl gene is located on chromosome 9, and the bcr gene is on chromosome 22. In certain forms of myelogenous leukemia, a reciprocal translocation causes the abl gene to fuse with the bcr gene. This combined gene, under the control of the bcr promoter, encodes an abnormal fusion protein that overexpresses the tyrosine kinase function of the ABL protein in white blood cells and leads to leukemia.

Normal Translocation chromosomes chromosomes Philadelphia chromosome 22 Direction bcry of bạr abl abl transcription Abnormal This translocation crossover results in the abnormal expression of a BCR/ABL fusion protein in white blood cells, thereby causing chronic myelogenous leukemia. FIGURE 25.13 The reciprocal translocation commonly found in people with chronic myelogenous leukemia. Genes-Traits In healthy individuals, the abl gene is located on chromosome 9, and the bcr gene is on chromosome 22. In certain forms of myelogenous leukemia, a reciprocal translocation causes the abl gene to fuse with the bcr gene. This combined gene, under the control of the bcr promoter, encodes an abnormal fusion protein that overexpresses the tyrosine kinase function of the ABL protein in white blood cells and leads to leukemia.

Name: Why does this translocation cause leukemia rather than cancer in a dif
Uploaded: 2024-03-20T06:43:04.000Z
Channel: Bartleby
Description: Why does this translocation cause leukemia rather than cancer in a different tissue type, such as the lung? NormalTranslocationchromosomeschromosomesPhiladelphiachromosome22Directionbcry ofbạrablabltranscriptionAbnormalThis translocationcrossoverresu

Human Heredity: Principles and Issues (MindTap Course List)

11th Edition

ISBN:9781305251052

Author:Michael Cummings

Publisher:Michael Cummings

Chapter7: Development And Sex Determination

Section: Chapter Questions

Problem 19QP: Equalizing the Expression of X Chromosome Genes in Males and Females Individuals with an XXY...

See similar textbooks

Similar questions

In contrast to their similar brain abnormalities,newborn mice deficient in Apaf1 or caspase-9 have dis-tinctive abnormalities in their paws. Apaf1-deficient micefail to eliminate the webs between their developing digits,whereas caspase-9-deficient mice have normally formeddigits (Figure Q18–1). If Apaf1 and caspase-9 function inthe same apoptotic pathway, how is it possible for thesedeficient mice to differ in web-cell apoptosis?
The chromosome 9/22 translocation associated withCML (chronic myelogenous leukemia) is called thePhiladelphia chromosome after the city in which itscancer association was first discovered in 1960.People with CML do not inherit this translocation—it occurs in somatic cells. Why do you think that thisparticular translocation that fuses the bcr and ablgenes happens independently in the somatic cellsof many different people?
Cornelia de Lange syndrome (CdLS) is a rare humandisease caused by a dominant loss-of-function mutation in any one of at least five different genes, all ofwhich encode components or regulators of the cohesin protein complex. People with CdLS have a widerange of morphological abnormalities, growth retardation, and mental impairment. Analysis of CdLS patients shows that in addition to chromosomalmis-segregation during cell division, their abnormalphenotype is likely due to widespread mis-regulationof gene expression during development. Cohesin mayplay a role in organizing chromatin loops necessaryfor proper regulation of transcription. (You will learnmore about this topic in Chapter 17.)a. In different families, CdLS can show an autosomaldominant or X-linked dominant inheritance pattern. How is this possible?b. Explain how a loss-of-function allele in a gene encoding a cohesin protein could be dominant to itswild-type counterpart.c. CdLS is usually caused by new mutation in oneparent’s…
Under normal physiological conditions, proto-oncogenes and tumor suppressorshelp control cell growth and proliferation. When mutated, these proteinscontribute to the development of cancer. Briefly detail the molecular basis of thisphenomenon
Homozygosity for extremely rare mutations in a humangene called SCN9A cause complete insensitivity topain (congenital pain insensitivity or CPA) and a totallack of the sense of smell (anosmia). The SCN9A geneencodes a sodium channel protein required for transmission of electrical signals from particular nerves inthe body to the brain. The failure to feel pain is a dangerous condition as people cannot sense injuries.The SCN9A gene has 26 exons and encodes a1977-amino acid polypeptide. Consanguineous matings in three different families have resulted in individuals with CPA/anosmia. In Family 1, a G-to-Atransition in exon 15 results in a truncated protein that is898 amino acids long; in Family 2, deletion of a singlebase results in a 766-amino acid polypeptide; and inFamily 3, a C-to-G transversion in exon 10 yields a458-amino acid protein.a. Hypothesize as to how each of the three SCN9Amutations affects gene structure: Why are truncatedproteins made in each case? b. How would you…
It is not an easy matter to assign particular func-tions to specific components of the basal lamina, sincethe overall structure is a complicated composite materialwith both mechanical and signaling properties. Nidogen,for example, cross-links two central components of thebasal lamina by binding to the laminin γ-1 chain and totype IV collagen. Given such a key role, it was surprisingthat mice with a homozygous knockout of the gene fornidogen-1 were entirely healthy, with no abnormal phe-notype. Similarly, mice homozygous for a knockout of thegene for nidogen-2 also appeared completely normal. Bycontrast, mice that were homozygous for a defined muta-tion in the gene for laminin γ-1, which eliminated just thebinding site for nidogen, died at birth with severe defectsin lung and kidney formation. The mutant portion of thelaminin γ-1 chain is thought to have no other functionthan to bind nidogen, and does not affect laminin struc-ture or its ability to assemble into the basal lamina.…
Diamond–Blackfan anemia (DBA) is a rare, dominantgenetic disorder characterized by bone marrow malfunction,birth defects, and a predisposition to certaincancers. Infants with DBA usually develop anemia in the firstyear of life, have lower than normal production of red blood cellsin their bone marrow, and have a high risk of developing leukemiaand bone cancer. At the molecular level, DBA is causedby mutations in any one of 10 genes that encode ribosomalproteins. The first-line therapy for DBA is steroid treatment,but more than half of affected children develop resistance tothe drugs and in these cases, treatment is halted. DBA can betreated successfully with bone marrow or stem cell transplantsfrom donors with closely matching immune system markers.Transplants from unrelated donors have significant levels ofcomplications and mortality. While a stem cell transplant from an unaffected donor is currentlythe only cure for DBA, genome-editing technologies mayone day enable the correction of…
Diamond–Blackfan anemia (DBA) is a rare, dominantgenetic disorder characterized by bone marrow malfunction,birth defects, and a predisposition to certaincancers. Infants with DBA usually develop anemia in the firstyear of life, have lower than normal production of red blood cellsin their bone marrow, and have a high risk of developing leukemiaand bone cancer. At the molecular level, DBA is causedby mutations in any one of 10 genes that encode ribosomalproteins. The first-line therapy for DBA is steroid treatment,but more than half of affected children develop resistance tothe drugs and in these cases, treatment is halted. DBA can betreated successfully with bone marrow or stem cell transplantsfrom donors with closely matching immune system markers.Transplants from unrelated donors have significant levels ofcomplications and mortality. Given that a faulty ribosomal protein is the culprit and causesDBA, discuss the possible role of normal ribosomal proteins.Why might bone marrow cells be…
Proto-oncogenes can be converted to oncogenes in a numberof different ways. In some cases, the proto-oncogene itselfbecomes amplified up to hundreds of times in a cancer cell.An example is the cyclin D1 gene, which is amplified in somecancers. In other cases, the proto-oncogene may be mutatedin a limited number of specific ways, leading to alterations inthe gene product’s structure. The ras gene is an example of aproto-oncogene that becomes oncogenic after suffering pointmutations in specific regions of the gene. Explain why thesetwo proto-oncogenes (cyclin D1 and ras) undergo such differentalterations to convert them into oncogenes
Fragile-X syndrome causes the most common form of inherited intellectual disability. What is the chromosomal abnormality associated with this disorder? What is the phenotype of this disorder?
Equalizing the Expression of X Chromosome Genes in Males and Females Individuals with an XXY genotype are sterile males. If one X is inactivated early in embryogenesis, the genotype of the individual effectively becomes XY. Why will this individual not develop as a normal male?
Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?