Q: Draw the structure of the a-keto acid formed by the transamination of each amino acid: (a) tyrosine…
A: arrow_forward
Q: The neural and hormonal control of the digestive system is divisible into three phases. Discuss the…
A: The digestive system includes the gastrointestinal tract and accessory digestive organs. The…
Q: what are the differant and similarites between TTX, STX and cocaine as pharmacological toxins
A: TTX (tetrodotoxin) fish toxin that blocks the pore of voltage-gated Na+ channels. saxitoxin (STX)…
Q: Describe the relationship between chromosomes, cells, and DNA 2. [Use Pictures] - How does…
A: The genetic information necessary for an organism to develop and operate is carried by the molecule…
Q: What does it mean when "Evolution is often circuitous rather than linear"? Explain in simple terms.
A: Introduction: The genetic makeup of a population changes through time, and this is what is meant by…
Q: 1. Definitions and brief statements 1. DNA Data Bank of Japan 2. MeSH Database 3. Please describe…
A: 1 DNA data bank of Japan -• An annotated collection of all publicly available nucleotide and protein…
Q: Describe the principle of CT scanning. Explain how coronal, sagittal and transverse images are…
A: Through computer processing, cross-sectional pictures (slices) of the bones, blood arteries, and…
Q: How does protecting and conserving a predator species increases the diversity in an area? Use the…
A: Predators contribute to the preservation of species variety in a community by diminishing the level…
Q: vaccines
A: Immune system: It is system of large network of organs,WBC, antibodies and chemicals. It works…
Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…
A: Peptide 1 is migrate most slowly during size exclusion chromatography
Q: Explain how E.coli. bacteria (prokaryotic species) and humans (eukaryotic species) reproduce? Design…
A: Introdiction:- Reproduction is a biological process by which an organism reproduces an offspring…
Q: If a post synaptic neuron is stimulated to threshold by spatial summation this implies that Select…
A: The nervous system is composed of millions of nerve cells called neurons. Synapses are junctions…
Q: 1.what does a slope if titration curve indicate? write down the functions of mixed indicators. 2.…
A: The science of chemical mechanism that occur within and relate to live beings is known as…
Q: Explain why trisomy X is not a lethal condition.
A: A female who has an additional X chromosome at birth is said to have triple X syndrome. It might be…
Q: Bacteriophage P22 was used in generalized transduction experiments to infect the Salmonella…
A: Transduction can be defined as a genetic engineering method that involves the insertion of foreign…
Q: 2. A 23-year-old Caucasian female presented to the emergency department (ER)with profuse watery…
A: INTRODUCTION - Diarrhoea is defined as passage of unusually loose or watery stools usually at least…
Q: What is the function of the sigma subunit of prokaryotic RNA polymerase? a. It directs the…
A: Introduction:- Transcription is defined as the process of RNA synthesis. It uses one strand of DNA…
Q: Electron microscopy of kidneys revealed tubules, which are lined by cuboidal epithelium. There are…
A: Connecting tubules and collecting ducts make up the collecting duct system. Arcades that drain…
Q: P₁ P₂ F₁ F2 3.3 days² 4.7 days² 6.6 days² 19.2 days² 12.1 days² a) Given the variances from these…
A: Heritability is the term used in breeding experiments in which one calculates the variation in any…
Q: Define reproduction. How does it help in providing stability to the population of species?
A: Introduction A population is a persistent group of an interbreeding individual of a species found…
Q: Which of the following is NOT a requirement for photosynthesis? Question 4 options: a)…
A: Photosynthesis is the process by which green plants and algae make organic food (glucose) out of…
Q: Thioredoxin is: oxidized, reduced activity causes the: inhibition, activation enzymes by: forming,…
A: Thioredoxin reductase are important redox proteins which regulate the balance generated in…
Q: 3. You have a protein that is easily extracted from a cell membrane preparation, without any…
A: INTRODUCTION : Cell membrane : It is also known as the plasma membrane, which is present in all…
Q: During an experiment, a virus is isolated from clinical samples. Electon microscopy shows that it…
A: The structure, replication strategies, and hosts that viruses infect differ among viruses. Most…
Q: A patient with poliomyelitis (which characterized by spinal cord damage) has disorder of skeletal…
A: Neurons are cells that transmit information in the form of electrical and chemical signals. They are…
Q: "The design of trans-Tango is modular, so it is not limited to tracing experiments. Since the…
A: It is certainly possible to further advance the trans-Tango system to label third-order neurons,…
Q: Nitrobacter and Nitrosomonas are sensitive to wide range of environmental factors. Which…
A: Biological nitrogen fixation is carried out by a highly conserved complex of proteins called the…
Q: In your own words explain endomysium and its function
A: Tissue is a group of cells that have a common origin and functions together to form specialised…
Q: 2. What happens when large natural and/or man-made deforestation occur?
A: 2. Deforestation is known as the purposeful clearing of forested land. Throughout history & into…
Q: A 40 year old man with a compliment deficiency agrees to participate in a clinical study of immune…
A: A class of autoantibodies known as C3 nephritic factors (C3NFs) allow for ongoing overactivation of…
Q: POTENTIAL IMPACT OF "Land use effect on benthic micro-invertebrate communities in streams".
A: Land use is a major global concern because the disturbances caused by it result in soil erosion,…
Q: Aside from hydration, pick two ways water's extraordinary properties affect living organisms.…
A: Water has a lot of essential properties that support life. It is also known as the universal…
Q: name two organism in which external fertilization take place .
A: Fertilization is a process in which two gametes fuse together which results in new individuals.…
Q: Which of the following cell types can directly regulate B cell activation and differentiation? 單選:…
A: The stimulation of the Th1 clones with immobilised anti-CD3 mAb greatly boosted the proliferation of…
Q: or the cactus (eukarotic) and the e coli bacteria (prokarotic) i want you to: Classify them based…
A: With the aid of dichotomous keys, it is possible to recognize patterns more easily. It helps to…
Q: What are the structures of Plasmids and Transposable elements in microbes?
A: Plasmids are circular, extrachromosomal DNA molecules that are separate from the chromosomal DNA.…
Q: From one molecule of glucose, what is the net yeild of ATP molecules produced through glycolysis and…
A: Aerobic cellular respiration mainly consists of four steps glycolysis, pyruvate oxidation, the…
Q: a- Select a plant that you eat regularly and mention its scientific name. How do we name the…
A: We have access to a wide variety of fruits and vegetables every day, including kiwi, apples, and…
Q: origins of neurodevelopmental disorders such as autism
A: Genome-wide association studies (GWAS) have been instrumental in uncovering the genetic basis of…
Q: Explain the additional health risks to a patient undergoing a CT scan as compared to an ordinary…
A: A CT (computed tomography) scan may more effectively capture bones and arteries all at once than an…
Q: What is the study of microorganisms
A: Microorganisms are tiny living things that cannot be seen with unaided eyes due to their small size.…
Q: Highlight how cell signalling is terminated at the level of receptor binding, G protein activation…
A: introduction G proteins regulate metabolic enzymes, ion channels, transporter proteins, and other…
Q: 15. The majority of blood vessels that carry blood towards the heart are: a) Veins b) Capillaries c)…
A: Blood vessels are circulatory system components that convey blood throughout the human body. These…
Q: Which of the following is likely to happen in a muscle cell in an anaerobic environment? Question…
A: During a glycolytic pathway, a glucose molecule is enzymtically degraded, producing either two…
Q: CD1 binds to 單選: A. MHC class II. B. polysaccharides. C. lipids. D. peptides. E. MHC class I. O O O…
A: The majority of cytotoxic T cells have T-cell receptors (TCRs) that can identify a particular…
Q: 1. Why is the red blood cell number in males more than in females? Is there a difference between…
A: Introduction : Red blood cells are also referred to as erythrocytes. They make up a significant…
Q: What is the main source of energy for ATP replenishment for Cellular Respiration?
A: Introduction ATP or adenosine triphosphate is known as energy currency of cell. All living…
Q: Muscles of the myometrium don't contract sufficient in the woman during childbirth. This is…
A: In females, the hollow muscular organ located in the pelvic region between bladder and rectum where…
Q: Typically, tropical plants have a higher stomatal density (# stomata/leaf area) when compared to…
A: Plants are living organism which carries out the process of photosynthesis and hence prepare their…
Q: What are the importance of sequence homology in strand invasion? Explain and answer this…
A: Sequence homology is an important concept in strand invasion, which plays a vital role in the…
Explain the following:
- discuss how language played as a vital part in human evolution.
- what development shows a big difference between homo sapiens and earlier homini species? discuss.
Step by step
Solved in 2 steps
- What do you think about the hypothesis that language evolved as a way for early hominins to communicate about stone-tool manufacturing? What other hypothesis could you come up with as to why language evolved in our Hominini tribe?what development shows a big difference between homo sapiens and earlier homini species? discuss.Write briefly about the "hobbit" species of hominin. What are the theories about its evolution? What was the species like? When and where did it exist? (Homo floresiensis)
- Throughout this class, we have reviewed important physical and behavioral traits that are used to define and distinguish hominins from each other. What do you think it means to be human? Would you include any physical or behavioral traits in your definition? Write at least 2 complete sentences.What are hominins? From the perspective of paleoanthropology, what are the main ways that hominins differ from our closest primate relatives the apes? What key physical features help anthropologists identify whether or...In the paper “Four Legs good, Two Legs Fortuitous...” what were the selective pressures that drove early hominin evolution? How was Australopithecus physically different from modern day Homo sapiens? How did these traits suit each species to their environment? Describe the role of bipedalism in Homo sapiens evolution. Approximately how early did bipedalism occur?
- In your own words, describe the technological innovations and cultural developments that characterized early human societies. How do these differ from archaic humans and early hominins, such as Australopithecines? Minimum of 3 sentences.The cladistic classification of apes and humans A. Divides hominids into hylobatids, pongids, and hominids B. Includes tarsiers, lemurs, and lorises C. Uses the term hominid to describe only humans and their ancestors D. Includes three subfamilies within hominids: Ponginae, Gorillinae, and HominiaeWhich of the following represent functions of the anatomical modifications toward more efficient bipedalism in hominins? Group of answer choices UV protection Brachiation Increased stride Shock absorption Balance Binocular vision Enchephalization
- What is the difference between the term hominid and hominin? Explain your answer.Discuss 4 anatomical changes that occurred in the bipedal hominin and how they reflect certain habitat adaptations, and then discuss the hypotheses that propose why the change occurred.Answer the Following: 1. Justify why A. afarensis is a type of hominid. 2. Why are chimpanzee behaviour studies important for our knowledge of early hominids? 3. What derived traits did Homo erectus and modern humans have in common? which derived characteristics are specific to H. erectus?
