for(x in lowest_mean_gene){ low_gene_exp<- as.numeric(AH_data[x,]) hist(low_gene_exp, main=x,breaks=40) }
Q: What is required of an attacker in order for a sniffer attack to be successful? If an attacker has n...
A: Introduction: The act of intercepting or recording data carried over a network is known as snooping ...
Q: In operating system, each process has its own a) address space and global variables b) open files c)...
A: Whenever a process is created it is assigned a virtual address space by the operating system. The gl...
Q: Translate source code into intermediate language that directly executes line by line. java-virtual m...
A: correct option is D (interpreter)
Q: Software Engineering You are making a Computer Science Exit Exam preparation app. Draw a use case di...
A: According to the information given:- We have to draw use case diagram for computer science exam prep...
Q: What impact has technology had on human behaviour in terms of cyber security?
A: Introduction: Perhaps the most difficult aspect of cyber security is the reality that humans are at ...
Q: Can you create a quotable quotes design(11 inches wide x 8.5 height, resolution 150 ppi) that includ...
A:
Q: Explain why it is critical that software products be built and deployed as soon as possible.
A: Software deployment: It is the process by which the software and application developers deliver soft...
Q: What was my understanding of the Internet before?
A: answer is
Q: You will write a program that will calculate the area of a square based on a randomly generated inte...
A: I give the code along with output and code screenshot in Python
Q: If for example you are creating a hospital database, can you identify which of the following are the...
A: entities: Nurse Hospital Physician
Q: How many comparsions would be needed for selection sort algorithm for these 3 types of arrays and al...
A: SELECTION SORT: The selection sort algorithm sorts an array by repeatedly choosing the smallest memb...
Q: What is the ready state of a process?
A: Answer: a. when process is scheduled to run after some execution The ready state of a process is...
Q: What are basic elements or c omponents of Linux?
A: Basic Components of the Linux Operating System are: Bootloader: Your computer must go through a star...
Q: Make a your own webpage, and make it presentable, informative and creative. Write a simple program...
A: I give the code along with code and output screenshot
Q: 1. Why is packet switching efficient? Explain your response. 2. Compare implicit allow and implicit...
A: Packet Switching Packet Switching is a method of transferring data in the form of packet. Packet sw...
Q: [0] [1] (2) [3] 5
A: We draw the diagrams for the given data structures after performing each operation. A is a queue, B ...
Q: Code three tests: 1) for a student who has courses 2) for student who does not have courses 3) a ...
A:
Q: There are several types of linear-programming models that exhibit a special structure which can be e...
A: There are several types of linear-programming models that exhibit a special structure which can be e...
Q: proof, Lemma double_modus_ponens : forall P Q R S : Prop, (P->Q) -> (R->S) -> (P /\ R) -> (Q /\ S). ...
A: (P->Q) -> (R->S) -> (P /\ R) -> (Q /\ S) P->Q=¬P∨Q R->S= ¬R∨S (P /\ R) = ¬(P∨R...
Q: Create a shared memory segment of 16 bytes. This segment is shared by two process A & B.
A: Th shmget system call is used to create the shared memory segment and generate the associated system...
Q: date man date file/ man -k password man-f passwd Man 5 passwd Info dațe Date -help Ls /usr/share/doc...
A: Here are the functions of above commands on Linux :- 1)date:- this command is used to display the sy...
Q: What is the output of the program? #include using namespace std; int main() { enum dayS { mon,tues,...
A: Option a: 15913
Q: T(n) = {3r6n – 1) + 1 n>1 Which of the following is the solution of recurrence relation? A. O(n²) B....
A: We have, T(1) = 1 = 1! T(2) = 2 x T(1) = 2 x 1 = 2! T(3) = 3 x T(2) = 3 x 2 x 1 = 3! T(4) = 4 x T(3)...
Q: Explain to me how to implement a generic linked list from scratch (Java) step by step (note: do not ...
A: Linked list : It is an ordered set of data elements, each containing a link to next link. Steps of ...
Q: What is the output of the following Python code? myList = {} myDictionary = [] myList[0] = "chegg" m...
A: Insert function inserts element at particular index in list.
Q: if we would like to represent merge sort in terms of occurence relation T(n)=aT(n/b)+f(n), what woul...
A: Given: Represent merge sort in terms of occurence relation T(n)=aT(n/b)+f(n), We have to discuss Wh...
Q: The internet is roughly doubling in size every 18 months. Although no one really knows for sure, one...
A: Given: Internet users in the year 2018. Condition: The users are roughly doubling every 18th month. ...
Q: main.c 1. Square to the Next Level by CodeChum Admin 1 #include 2 3 - int main(void) { We've already...
A: #include <stdio.h> int main(){ int num[100] = { 2, 3, 5, 100, 7, 3, 5, 3, 1, 4, ...
Q: In this exercise, we will write a program to find the sum of all numbers between any two seeded rand...
A: Since programming language was not mentioned , So I chosen PYTHON I have provided PYTHON CO...
Q: Translate to LEGv8
A: Used fgets() instead of gets() which is deprecated. fgets() takes three paramters: 1. Pointer to cha...
Q: 2. Find the value of square root of 5 using a maximum of 4 iterations of Newton Raphson method. (hin...
A: The question is to find the root of the equation using Newton Rapson method.
Q: Writepseudocodethatperformsthefollowing:Askausertoenteranumber.Ifthe number is between 0 and 10, wri...
A: Pseudocode is an informal way of describing a program that does not require any strict programming l...
Q: need a Data Model Design diagram for attendance fingerprint system
A: Solution : In below mentioned screenshot Data Model Design for attendance fingerprint system is sho...
Q: What would happen if database referential integrity was not enforced? What are the most probable err...
A: Introduction: The association between tables is referred to as referential integrity. Because a prim...
Q: Write a CSS rule that places a background image halfway down the page, tiling it horizontally. The i...
A: Introduction: The layout of a webpage is formatted using Cascading Style Sheets (CSS). Color, font, ...
Q: Can i please have help with this question in java, please read the intructions and write down the co...
A: According to our rules we are assume to address initial three sub question. Compassionate repost oth...
Q: a)Object Points and Function Points are general, high level system size metrics. Which aspects of th...
A: a) Productivity is expressed as the number of function points that are implemented per person-month....
Q: By using the Big-O definition and formal proof, show and prove that a function y=n*+3 can't belong t...
A: For a given function g(n), we have set O(g(n)) = { f(n) : there exist positive constants c and n0 su...
Q: main.c 7. That One Digit by CodeChum Admin Make me a program that accepts a random string (a series ...
A: I give the code in C as per your requirement along with output and code screenshot
Q: The ArraySet method add searches the entire set. Discuss the consequences of this search of the enti...
A: Introduction: Input :A = {0, 2, 4, 6, 8}B = {1, 2, 3, 4, 5} Output : Union : [0, 1, 2, 3, 4, 5, 6, 8...
Q: C++ Write a program to find the sum for the following series: اكتب برنامج لايجاد المتسلسله التاليه :...
A: Given: To write C++ program to find sum of series: (1*10) +(3 *10) +(5*10) +..... (n*10)
Q: 10.4 (THE MYPOINT CLASS) Design a class named MyPoint to represent a p with x- and y-coordinates. Th...
A: I give the code in Java eclipse along with output and code screenshot
Q: Write a program that takes in a line of text as input, and outputs that line of text in reverse. The...
A: Code with explanation: lst = [ ] // list to store the input strings.lt=[] // list to store the r...
Q: Which Win32 function moves the file pointer to a specified offset in relation to the beginning of a ...
A: Introduction: SetFilePointer: SetFilePointer is a built-in Win32 API function that modifies the pos...
Q: What are some of the best ways to put up a firewall ?
A: Introduction: All traffic is prohibited by default, and only specific traffic to recognised services...
Q: When the target string includes a digit, what occurs in the Str ucase method from Section 9.3?
A: Solution !! Str_ucase procedure The Str_ucase procedure is used to convert a string to all upperca...
Q: In this VB.net Program write in Algorithm(Pseudocode). Thank you Module VBModule Sub Main() ...
A: The Pseudo code is given below.
Q: linked list is an object that creates, references and manipulates node objects. In this assignment,...
A: The answer is given below:-
Q: 3. Explain the following with respect to 8086 Microprocessor. a. Procedures with example b. Differ...
A: A microprocessor is a computer processor where the data processing logic and control is included on...
Concepts in Designing Database
A database design is the process of data organization based on a database model. The process deals with identifying what data should be stored in a database and how data elements relate to each other.
Entity Relationship Diagram
Complex real-world applications call for large volumes of data. Therefore, it is necessary to build a great database to store data safely and coherently. The ER data model aids in the process of database design. It helps outline the structure of an organization’s database by understanding the real-world interactions of objects related to the data. For example, if a school is tasked to store student information, then analyzing the correlation between the students, subjects, and teachers would help identify how the data needs to be stored.
![8TT
119
120
121
122
123
124
125
126
127
128 for(x in lowest_mean_gene){
Low_gene_exp<- as.numeric(AH_data[x,])
hist(low_gene_exp, main=x,breaks=40)
129
130
131 }
132
133
134
135
136
137
138
139](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2Fdb23fdff-6d05-4719-9c44-2c15efa878db%2Fd70191d9-18f1-46e0-9e6a-8bd2be097bc7%2F7et8b3v_processed.jpeg&w=3840&q=75)
Step by step
Solved in 2 steps
- 427387350304450293426468451389380370387308319335312412308358514444443324508424390426410417 Class Frequency 1. ___ -___ ____ 2. ___ -___ ____ 3. ___ -___ ____ 4. ___ -___ ____ 5. ___ -___ ____ 6. ___ -___ ____ 7.___ -___ ____ 8. ___ -___ ____ Construct a frequency histogram of the data. Descibe any patterns.What are The DNA Fragment Assembly Problem in machine learning?MIPS Assembly Complete gcd_cur function, which recursively calculates the GCD (Greatest Common Divisor) of two given positive integers input using the following Euclidean algorithm (Links to an external site.). def gcd_recur(a, b): if b = 0: return a; else: return gcd_recur( b, (a mod b) ); >> a0: the 1st input argument, a>> a1: the 2nd input argument, b ############################################################################################################################################################################################## PART 2 (gcd_recur)#a0: input number#a1: input number###############################################################gcd_recur:############################### Part 2: your code begins here ## ############################### Part 2: your code ends here ##jr $ra
- PYTHON/ Computational stoichiometry Make an organized output of the species and stoichiometric data for the reaction series : r0 : C(s) -> C(g)r1 : 2 C(g) + O2 -> 2 COr2 : CO + 0.5 O2 -> CO2r3 : C(g) + H2O -> CO + H2r4 : CH4 <=> C(g) + 2 H2 A sample code has been provided to guide your results, please follow as closely as you can to obtain the right answer. '''Create the species list''' species_tmp = list() # temporary list for species for r in reactions: left = r.split('<=>')[0].strip() # reactants side right = r.split('<=>')[1].strip() # products side left_terms = left.split('+') # reactant species w/ stoichiometric coeff. right_terms = right.split('+') # product species w/ stoichiometric coeff. terms = [t.strip() for t in left_terms] + [t.strip() for t in right_terms] # concatenate list comprehensions for i in terms: tmp = i.split(' ') # split stoichiometric coefficient from species name…MIPS Assembly Complete gcd_cur function, which recursively calculates the GCD (Greatest Common Divisor) of two given positive integers input using the following Euclidean algorithm (Links to an external site.). def gcd_recur(a, b): if b = 0: return a; else: return gcd_recur( b, (a mod b) ); >> a0: the 1st input argument, a>> a1: the 2nd input argument, b My Code: ############################################################################################################################################################################################## PART 2 (gcd_recur)#a0: input number#a1: input number###############################################################gcd_recur:############################### Part 2: your code begins here #### return value is v0move $t0, $a0 move $t1, $a1 loop: beq $t1, $0, done div $t0, $t1 move $t0, $t1 mfhi $t1 j loop done: move $v0, $t0…Write an R script to identify the differentially expressed genes at P < 0.01 of Saccharomyces Cerevisiae grown in YPD and Delft.
- Data Given : 5Belinda, 4CSCI212CSCI235CSCI222CSCI203Calvin, 3CSCI205CSCI204CSCI222Johnathan, 4CSCI212CSCI222CSCI204CSCI203Ann, 2CSCI204CSCI213Brandon, 4CSCI212CSCI203CSCI235CSCI213PLEASE SEND SCREENSHOT OF CODE AND OUTPUT WHICH EXECUTED AT ANY PYTHON COMPILER. Train an artificial neural network using CIFAR10 dataset at any python compiler. You can get the dataset from Keras similar to mnist dataset - try to find the best performing model for your dataset (CIFAR-10), use the splitting for train/val/test as 80/10/100 PLEASE SEND SCREENSHOT OF CODE AND OUTPUT WHICH EXECUTED AT ANY PYTHON COMPILER.For the data set {(ai, 6), (ml, 7), (ds, 3), (os, 1), (se, 2)} build a treap. Perform deletion of (ml, 7) over the treap and insert (ps, 7) into the deleted treap
- In this question you are to write MIPS assembly language procedures insert and search for a quadtree data structure, and a main program to test them. Each node of the tree should be implemented with six consecutive words of memory, as shown below: x value y value NW child ptr NE child ptr SE child ptr SW child ptr address a address a+4 address a+8 address a+12 address a+16 address a+20 Each of the four child pointers (NW child ptr, NE child ptr, SE child ptr, and SW child ptr) gives the memory address of the first word of the corresponding child node. A pointer (memory address) value of zero indicates that there is no such child node. The tree nodes should be linked such that for a node with (integer) values (X,Y) all nodes in its NW subtree have x value less than or equal to X and y value greater than Y, all nodes in its NE subtree have x value greater than X and y value greater than or equal to Y, all nodes in its SE subtree have x value greater than or equal to X and y value less…We think that Flynn's taxonomy should grow by one level. Among all the other computers, what makes these computers stand out from the rest?What is the count of positive and negative charges in the amino acid sequence “YEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV”? (Solve this using Python; not by hand). Compute the transition matrix for the sequence in “dna.txt”. The transition matrix tells you the number of times you move from one nucleotide to another. For instance, in the sequence AATACGAT, AA occurs once, AT occurs twice, AC occurs once, TA occurs once, CG occurs once, GA occurs once, and all other combinations occur 0 times. Print out the transition matrix. (here imagine Dna.txt is a dna sequence file)