Answered: In the peptide shown below, a covalent…

In the peptide shown below, a covalent bond that could rotate to form secondary structure is correctly identified/labeled by letter: ܟܢ ܕ 1 C HN "OH NH "NH₂

Biology (MindTap Course List)

11th Edition

ISBN:9781337392938

Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Publisher:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Chapter3: The Chemistry Of Life: Organic Compounds

Section: Chapter Questions

Problem 9TYU: Which of the following levels of protein structure may be affected by hydrogen bonding? (a) primary...

See similar textbooks

Related questions

Q: The major secondary structure seen in collagen is: a) alpha helix b) beta sheet c) collagen…

A: We provide the answer to the first question. Please repost your question separately for remaining…

Q: 7. Which of the following statements is true about enzyme-catalyzed reactions? a The reaction is…

A: The reaction which occurs in the presence of an enzyme is called enzyme catalysed reaction.Enzymes…

Q: Draw a diagram to illustrate the locations of the omega (w), phi (p), and psi (4) rotational bond…

A: Omega (ω), phi (ϕ), and psi (ψ) angles are used to illustrate how atoms rotate along the polypeptide…

Q: The active form of insulin contains No disulfide bonds Intra-chain disulfide bonds Inter-chain…

A: Insulin is a peptide hormone secreted by beta cells of pancreatic islets of Langerhans that…

Q: Balance the basic equation of oxidative metabolism.

A: Oxidative metabolism is a fundamental biochemical process that occurs within cells to generate…

Q: Which statement about the glycoprotein shown below is true? OH CH₂OH OH HN HN-C O CH3 H₂ Protein CH…

A: Chemically, carbohydrates are polyhydroxy aldehydes or ketones. Monosaccharides are single unit…

Q: Draw the structure of lysine,arginine, and Cysteine in the protonation state that would predominate…

A: There are four classes of biological macromolecules. They are proteins, nucleic acids, carbohydrates…

Q: The ionization of p-nitrophenol is shown below (pKa = 7.0): a. Identify the weak acid and conjugate…

A: Since you have posted multiple questions with multiple sub parts, we will provide the solution only…

Q: Devise a solution-phase synthesis of Ala-Leu-Val-Phe-Met, starting from the requisite Boc-protected…

A: Solution phase synthesis is a organic chemistry technique where the synthesis takes place in a…

Q: The change in Gibbs free energy under biochemical standard-state conditions is represented by AG°'.…

A: Details

Q: In a sequence of amino acids, a non-polar amino acid is mutated into a polar charged amino acid.…

A: Protein or a polypeptide chain is made up of amino acids linked together by peptide bonds. Protein…

Q: label the answer

A: Functional group is a substituent or moiety in a molecule which provides specific characteristics to…

Q: Which of the following biomolecules is not present in the cell membrane (in any form Proteins O…

A: Biological membranes are bilayered structures that surround the cell or organelle and act as…

Q: Why is having flexible and unstructured regions of a protein important for the function of the…

A: Proteins are polypeptide structures made up of one or more extended chains of residues from the…

Q: What is the total mass of oxygen in a single molecule of glucose? Express your answer in amu to 5…

A: Glucose is a carbohydrate, a monosaccharide. In most living cells, glucose is oxidised completely…

Q: Label the key components of a matrix-assisted laser desorption/ionization time-of-flight, or…

A: Matrix assisted laser desorption ionization-time of flight mass spectrometry (MALD1-TOF) is a…

Q: Creatinine, C4H7N3O, is a by-product of muscle metabolism, and creatinine levels in the body are…

A: Let's calculate the mass of creatinine in a 10.0 mL blood sample. The normal level of creatinine in…

Q: Draw a diagram of the aspartic acid side chain in the protonated and unprotonated states. Calculate…

A: The four classes of biological macromolecules are proteins, nucleic acid, lipids and…

Q: Standard reduction potentials for zinc (II) and copper(II) The standard reduction potential for a…

A: The given question relates to E0cell E0cell = E0cathode - E0anodeE0 indicates standard reduction…

Q: Calculate the net charge of the following peptide at pH 2, pH 6 and pH 14 (use 2 and 9 as pKa values…

A: The ionizable groups in a peptide include its N-terminal alpha-amino group, C-terminal…

Q: Would you expect the pKa to be higher or lower than 8 if the group were buried in the hydrophobic…

A: PKa value is the measure of the tendency of a group to give up a proton. PK a is actually a…

Q: 3) After watching the video convert the monosaccharides from a Fischer to a Haworth Projection. c)…

A: Fischer and Haworth ProjectionsFischer and Haworth projections are two ways of representing the…

Q: Which of the above curves corresponds to myoglobin in a solution containing physiological…

A: The given curve is an oxygen dissociation curve. The curve depicts the relationship between the…

Q: xplain the structure and components of a typical URI. Provide examples of common URI schemes.

A: A URI (Uniform Resource Identifier) is a string of characters that uniquely identifies a resource…

Q: Beta sheets shown in the figure below are: "" Parallel Not enough information One strand is parallel…

A: Here it is clearly mentioned that what its helical secondary structure.

Q: Consider the reaction. 2XY+Z When the concentration of X is doubled, the reaction rate increases by…

Q: Refer to the figure below, what are the following forces of attraction is involved in the protein…

A: The tertiary structure of the protein is a 3D structure established and stabilised by the…

Q: What is the hydrogen bonding pattern within an alpha helix? a. Lone pair on C=O of residue i to…

A: We have to determine the hydrogen bonding pattern within an alpha helix

Q: Which of the following is not a characteristic of an isoprene unit? Alternate triple bonds Five…

A: Details

Q: Consider beta-sheet comprised of twelve amino acid residues (two strands of six residues each). How…

A: Proteins are the macro molecules that show great diversity in their structure. They show four levels…

Q: Select the choice that best describes the stereochemistry of the following amino acid, and rank the…

A: Cysteine is one of the amino acids which contains a sulphur atom in it's side chain. Like other…

Q: Tyrosine came from the Greek word "tyros" which means cheese as it was discovered in cheese by…

A: Tyrosine is a non-essential amino acid that can be produced in the body by using phenylalanine as a…

Q: Draw an oxygen binding curve of Hb at a pH of 7.4 and another curve where all 2,3 BPG has been…

A: Hemoglobin is a heterotetrameric oxygen transport protein that is found in red blood cells or…

Q: Draw the amino acids serine and threomine bonded together with a petide bond.

A: Amino acid

Q: PROTEINS 1. What will happen to free arginine after being subjected to biuret analysis (is it…

A: Proteins are large, complex biomolecules composed of multiple peptide-bonded amino acids. Proteins…

Q: Sickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as…

A: d. In sickle cell anemia patients, 100% of the hemoglobin assembled contains the mutant β globin,…

Q: 3) After watching the video convert the monosaccharides from a Fischer to a Haworth Projection. a)…

A: Fischer and Haworth ProjectionsFischer and Haworth projections are two ways of representing the…

Q: What are the advantages of normalizing against a reference gene in qPCR?

A: PCR stands for Polymerase Chain Reaction, and it is a widely used method that allows us to make many…

Q: A C R > N-H R O X₂ X² Ω· R ©Ð»>«< N-H C=O--HOR (N-H R R E R Type your answers in all of the blanks…

A: A hydrogen bond is a non-covalent, relatively weak, chemical bond in which a hydrogen atom…

Q: Eukaryotic cells contain many compartmentalized organelles. Label each organelle in this eukaryotic…

A: The cell is the basic unit of life. It is made up of many smaller structures called organelles.…

Q: Draw beta sheet with backbone hydrogen bonds, is this structure on the interior or exterior of the…

A: A typical structural motif in proteins is a beta sheet, commonly referred to as a beta strand. It is…

Q: If the half-life for the decomposition of a drug is 4 hours, how long will it take for 225 mg of the…

A: In order to solve this problem, first we need to calculate the decay constant (). The half life…

Q: What is mass fragmentography? How is this performed?

A: Mass fragmentography is also known by the name mass fragmentometric analysis or mass fragmentography…

Q: Recall that when we calculated the fraction of estrogen receptors occupied in the presence of 1 nM…

A: To calculate the concentration of free receptor (Rfree) in terms of the total concentration of…

Q: CH3 нно │ │ | wwN-C-C-N-C-C-N-C-Cmw H | | I нно serine leucine alanine Determine which amino acids…

A: Peptides are polymers of amino acids. Amino acids are simply an alpha-carbon bonded to 4 different…

Q: What is it about alpha helices and beta sheets that would make the coils less flexible?

A: The structure of proteins is a fascinating realm of biology and chemistry. Within the hierarchy of…

Q: 3. The compound 5-hydroxymethyl furfural forms while heating or cooking sugar-containing foods. HO…

A: Fructose is a monosaccharide, a ketohexose, a poly hydroxy ketone made up of 6 carbons.Fructose can…

Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…

A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…

Q: Draw both a parallel and an antiparallel beta-sheet using a ribbon diagram and use arrows to show…

A: The different levels of structural organization in a folded protein are primary, secondary, tertiary…

Q: Which one statement below is true about the metabolism of rizatriptan? N N-N ZI rizatriptan MaxaltⓇ…

A: 3.It is a prodrug that is activated by esterases.Rizatriptan is indeed a prodrug, which means it is…

Question

In the peptide shown below, a covalent bond that could rotate to form
secondary structure is correctly identified/labeled by letter:
с
E
OH
Thill find
-OH
HN
NH
"NH₂

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1: Protein secondary structure

VIEW

Step 2: Dihedral angles and their effect on peptide folding

VIEW

Step 3: Assessment of the given structure for solution

VIEW

Solution

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 4 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

Which of the following levels of protein structure may be affected by hydrogen bonding? (a) primary and secondary (b) primary and tertiary (c) secondary, tertiary, and quaternary (d) primary, secondary, and tertiary (e) primary, secondary, tertiary, and quaternary
Suppose that the given peptide below is a segment in a globular protein's primary structure. Determine what would most likely be the type of secondary structure that it will form. Explain. T-L-S-A-R-I-D-V
Suppose that the given peptide below is a segment in a globular protein's primary structure. Determine what would most likely be the type of secondary structure that it will form. V-E-S-A-L-D-I-F-R-T-A-L-S
Write the chemical structure of peptide containing the following amino acid PRO-SER-GLY-LEU
Form DIANINE name using the one-letter symbol and draw it as a peptide chain. Name the peptide as well.
For the protein given in the attached picture: Write the name of these 5 amino acids corresponding to their abbreviation of 3 letters. Describe precisely how the functional groups in the amino acids are involved in bonding between two successive amino acids in the protein.
Label the N- & C termini Label ALL alpha -carbons (with an alpha) Label ALL peptide bonds(highlight or draw an X through these) Circle all AAresidues label which ones are nonpolar, polar,-acidic, & basic For each side chain, label/identifywhat types of R - group interactions it canparticipate in (H - bond, disulfide bond, ionic/electrostatic interactions, or hydrophobicinteractions.) Peptide Structure
I-D-E-L-Y-S-Q-V-C-S-H-L-D-T-V-R This amino acid sequence forms an alpha helix. What side would face the solvent and what side would face the inside of the protein when thinking of the tertiary structure?
A peptide has the following sequence: Glu – His – Trp – Ser – Gly – Leu – Arg – Pro – Gly Using a table of pKa values, determine the net charge of the molecule at pH 3 pH8 pH 11
Suppose that the given peptide below is a segment in a globular protein's primary structure. Determine what would most likely be the type of secondary structure that it will form. S-E-P-P-T-E-G-P
How many peptide bonds are present in the peptide shown below?
Consider the peptide L-E-T-S-P-R-A-Y Which amino acid(s) is/are basic? A. Y B. P C. R D. L E. T F. S C. A H. E