Can you please explain to me what is happening in this image Person with Galactosemia:GalactoseGALK:proteinAlteredGALT protein proteinGALEA problem with any one of these proteins (andthe gene that codes for it) causes galactosemia.Galactose builds up to harmful levels.

Galactosemia is a rare genetic condition of carbohydrate metabolism that impairs the body's capacity…

Answered: Person with Galactosemia: Galactose…

Person with Galactosemia: Galactose GALKI protein GALE Altered GALT protein protein A problem with any one of these proteins (and the gene that codes for it) causes galactosemia fulle

Biology: The Unity and Diversity of Life (MindTap Course List)

14th Edition

ISBN:9781305073951

Author:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr

Publisher:Cecie Starr, Ralph Taggart, Christine Evers, Lisa Starr

Chapter9: From Dna To Protein

Section: Chapter Questions

Problem 14SQ: Energy that drives translation is provided mainly by_________. a. ATP b. amino adds c. GTP d. all...

See similar textbooks

Related questions

Q: mentum Learn... 1 v My virtual Academ... Next 1 Genetic Mutations: Mastery Test Select the correct…

A: Introduction :- The lac operon is a single-promoter operon, or collection of genes (transcribed as a…

Q: Whether the statement "In normal adult tissues, cell death usually balances cell division." is true…

A: Introduction:In eukaryotic metazoan organisms, regulated cell death is a puzzling but essential…

Q: The reason why incidence of osteosarcoma and colon cancer do not have same sort of age dependence.

A: Colorectal cancer, commonly referred to as bowel cancer or colon cancer, is an abnormal cell growth…

Q: Which of the following is true of the molecule below? nucleotide 3' H₂C T HN O..HN CNH.NG NH O A…

A: First question: the given molecule is that of a DNA molecule which is a polymer of nucleotides. A…

Q: Explain the overexpression of a protein that binds to the Fas ligand contributes to the survival of…

A: A transmembrane protein called Fas ligand is found on the surface of lymphocyte cells. It binds to…

Q: The following segment of DNA is part of the RNA-coding sequence of a transcription unit. If the…

A: Introduction Deoxyribonucleic acid is a polymer made of two polynucleotide chains that coil around…

Q: Transduction of a stimulus usually causes depolarization of a sensory receptor. a.)In most…

A: a) The depolarization occurs by the generation of potential which causes action potentials because…

Q: Name: In addition to revealing clues about evolution, physical traits can also give clues to the…

A: Introduction Any net change in direction or any cumulative change in the traits of individuals or…

Q: Are biogas plants and anaerobic digestion(AD) plants the same thing? Are there any anaerobic plants…

A: The biological breakdown of organic compounds by bacteria is known as anaerobic digestion. "Organic"…

Q: Kari and Jamal are studying a genetic trait that is controlled by two genes, Gene 1 and Gene 2. Kari…

A: In molecular biology there is a theory called central dogma of life. This theory states that the…

Q: 1. What does MacConkey select for? How does it select these particular bacteria? What will not grow…

A: Microbial culture refers to the cultivation and maintenance of bacterial and fungal pure cultures.…

Q: The FOV on low power of a microscope is measured to be 4.5mm. Using the chart below and the above…

A: *So, our FOV is approximately 4.5mm. *we can perform a simple calculation to determine the…

Q: Molds from the Rhizopus genus are probably the best known species of zygomycete fungi. Please find…

A: Fungi can function as decomposers, parasites, recyclers, and symbionts. They frequently create…

Q: Describe the size (in base pairs) of the bands anticipated for Digested TT DNA Digested Tt DNA…

A: Gel electrophoresis is a process of separation of DNA fragments based on their size. Different size…

Q: F2 All tissues have dual innervation of the sympathetic and parasympathetic nervous systems. O True…

A: We know that It regulates and controls all the body's activities, including voluntary and…

Q: Two Students Studying Genes Kari and Jamal are studying a genetic trait that is controlled by two…

A: Introduction Gene expression is the process through which information from our DNA is transformed…

Q: What was a key finding from research that contributed to the widely accepted fact that smoking leads…

A: Cancerous cells are cells which divide uncontrollably, without differentiating. There can be…

Q: Which of the following drugs in the treatment of Alzheimer's Disease helps normalize glutamate by…

A: It is a neurodegenerative disorder( caused by progressive loss of function of neurons) which usually…

Q: 10. In many viral diseases illness occurs shortly after exposure to the virus. In other cases, the…

A: Viruses are obligate parasites and they are different from other microorganisms with respect to…

Q: Which of the following is NOT a reason cells regulate gene expression at a level other than the…

A: Introduction : A functional gene product is created through the process of gene expression…

Q: 7. Explain why site-directed mutagenesis of aspartate to asparagine in the active site of trypsin…

A: Introduction :- Deoxyribonucleic acids (DNA) in an organism change through the process of…

Q: Cell contains 1 set of unreplicated chromosomes A Process 1 A What has happened during Process 2?…

A: The diagram in the question shows the process of cell cycle. "A" represent the parent cell. "B"…

Q: Which of the following is the most predictable outcome of increased ge ulations? ower average…

A: A gene is a section of DNA where a function is encoded. A chromosome is a lengthy DNA strand that…

Q: Describe, The negatively charged glycosaminoglycan polysaccharide chains establish a hydrated…

A: Introduction:The polysaccharide chains made up of disaccharide monomer units are known as…

Q: As development progresses, individual cells become more and more restricted in the range of cell…

A: Development biology concerns the basic characteristic features of development of an organism almost…

Q: Briefly describe the mechanisms of aspiration breathing in three groups of “reptiles”. (Explain…

A: When reptiles breathe, they use a process called aspiration breathing. This type of breathing…

Q: Part of the protein-coding region in a gene has the base sequence 3- ACAGCATAACGTTC-5'. What is the…

A: The molecule inside cells that contains the genetic information responsible for the development and…

Q: What type of damage does UV light do to DNA?

A: 1) What UV light or Radiation must be doing to cells or DNA?

Q: Bacterium A Indole H2S Production Motility Bacterium B Appearance of Positive Result Result from…

A: Indole Test: The indole test is a biochemical procedure used to assess a bacterial species' capacity…

Q: An anticodon is 5' CGA 3'. The codon that pairs with the anticodon will be a) 3'UGC5' b) 5'GCT3' c)…

A: Transcription: "It is the process through which the enzyme RNA Polymerase transfers information from…

Q: "Were the various types of cells to lose their stickiness for one another and for the supporting…

A: In the majority of tissues, transmembrane proteins that are intracellularly connected to the…

Q: In insect embryonic development, the fertilized egg nucleus divides repeatedly giving rise to…

A: Embryonic development in insects The period of development of embryo starts at fertilization and at…

Q: Name and define the three models to describe the nexus between drug use and crime.

A: The nexus between drugs and crime:*Crime and illicit drug use, especially the use of narcotics…

Q: Describe local coadaptation in the evolutionary arms race among garter snake and newts?

A: A particular type of coevolution known as an arms race is characterized by increasing levels of…

Q: e diagram below showing halves of four DNA replication bubbles, RNA. red and DNA is shown as black.…

Q: Using the mRNA sequence you made, translate this into a protein sequence. Begin translation at the…

A: The genetic code, which connects the DNA sequence to the amino acid sequence in proteins, is read…

Q: Question 8 This passage is adapted from Allie Wilkinson, "Panda Guts Not Suited to Digesting…

A: Organisms that derive their food from the surroundings are called heterotrophs. Plants are…

Q: Question 3 What gene expression control do you have after translation control for eukaryotic cells?…

A: Translation is a molecular process where the mRNA produced is further processed to protein by…

Q: fungi are important in human health

Q: 10) If the bacterium Staphylococcus aureus experiences a cost for maintaining one or more…

A: Staphylococcus aureus becomes drug-resistant. Genetic mutation is the process that decreases…

Q: 3. Use the diagram below of the three different types of blood vessels to answer the following: a.…

A: "Since you have asked multiple questions from Different topics and also you haven't mentioned which…

Q: Explain "integrins can convert mechanical signals into intracellular molecular signals" is true or…

A: Mechanotransduction is the process by which mechanical signals are transformed into biochemical or…

Q: Describe in sentences how having organelles makes eukaryotic cells complicated chemically (ex. able…

A: Introduction Eukaryotic cells are complicated chemically (ex. able to do a greater variety of…

Q: Bruxism is a condition in which individuals clench and/or grind their teeth. It often occurs as they…

A: Introduction Bruxism is excessive teeth grinding or jaw clenching. It is an oral parafunctional…

Q: A Animals have cells of various sizes and shapes. Fat cells are roughly spherical and can be quite…

A: Digestive system: The mouths, pharynx (throat), oesophagus, stomachs, intestinal tract, bowel,…

Q: The (blanK) gene is inducible (needs a certain nutrient to make protein) and the protein is only…

A: *Inducible genes: are those that have variable activity depend on the needs of cell. For…

Q: What are the differences and similarities between Transmission Electron Microscope (TEM) and…

A: An electron microscope is a microscope that uses a beam of accelerated electrons as a source of…

Question

Can you please explain to me what is happening in this image

Person with Galactosemia:
Galactose
GALK:
protein
Altered
GALT protein protein
GALE
A problem with any one of these proteins (and
the gene that codes for it) causes galactosemia.
Galactose builds up to harmful levels.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

Energy that drives translation is provided mainly by_________. a. ATP b. amino adds c. GTP d. all are correct
fill in the blanks The enzyme responsible for alpha 1,4-glycosidic linkage during glycogen synthesis is ( ) and alpha 1,6-glycosidic linkages are added using the ( ) enzyme.
People with galactosemia display central nervous system abnormalities even if galactose is eliminated from the diet. The precise reason for it is not known. Suggest a plausible explanation.
All are both ketogenic and glucogenic amino acids except Group of answer choices Tyrosine Arginine Phenylalanine Isoleucine
Only do the following- synthesize a monoglyceride and diglycerides and attach them below. Make sure to identify which is which!
6) Galactosemia, is the inability to metabolize: a) Galactose b) Fructose c) Glycogen d) Lactose
True or False 1. Predominant nucleotides during protein synthesis are the GTPs. 2. Predominant nucleotides during protein synthesis are the GTPs. 3. The nucleoside monophosphates are seen in metabolic pathways because their phosphoric anhydride bonds can be hydrolyzed off for energy.
Is phosphate H2PO4 non polar or polar
Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
Protein folding with PDI and Peptidyl-prolyl isomerase
In the ER lumen nascent polypeptide chains are kept from misfolding or aggregating until an entire domain or polypeptide is completed and can fold properly. true false
Ubiquitin Marks Cytosolic Proteins for __________ in Proteasomes.