a beta-pleated sheet structure formed by hydrogen bonding between the backbone atoms the structure when two or more polypeptides form a single three-dimensional unit 1. primary protein structure an alpha-helix structure formed by hydrogen bonding between the backbone atoms on the 2. secondary protein structure 3. tertiary protein structure backbone 4. quaternary protein structure a structure that is primarily determined from interactions between R groups on the backbone peptides the structure that is determined by the amino acid sequence of a protein

a beta-pleated sheet structure formed by hydrogen bonding between the backbone atoms the structure when two or more polypeptides form a single three-dimensional unit 1. primary protein structure an alpha-helix structure formed by hydrogen bonding between the backbone atoms on the 2. secondary protein structure 3. tertiary protein structure backbone 4. quaternary protein structure a structure that is primarily determined from interactions between R groups on the backbone peptides the structure that is determined by the amino acid sequence of a protein

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter3: Biological Molecules: The Carbon Compounds Of Life

Section: Chapter Questions

Problem 8TYK: The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices...

See similar textbooks

Similar questions

Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
Only qno3m I think protein drawing has to show the bond interactions Onlyqno3 solve. I. Given a polypeptide below, answer the following questions: MAGGMIVIIGGMGCNSMVVVIIIGTSSCVIMEMMMIVKII Questions: 1. Enumerate all non-polar amino acids. (Provide the single letter and common name) 2. Enumerate polar amino acids include the acidic and basic types. (Provide the single letter and common name) 3. Illustrate the overall shape of the given polypeptide. Point out the specific side-chain interactions that could occur in this polypeptide by labelling the polypeptide. Defend your answer as to why your polypeptide should assume such final shape. Only accurate drawing need
Denaturation changes which protein structure(s)? SELECT ALL THAT APPLY Primary Structure Secondary Structure Tertiary Structure Quaternary Structure
Indicate the level(s) of protein structure to which each of thefollowing contributes:a. amino acid sequenceb. b-pleated sheetc. hydrogen bondd. disulfide bond
Which level(s) of protein structure result(s) from non-covalent interactions involving both backbone groups and side chains? (Select all that apply!) a) Primary b) Secondary c) Tertiary d) Quaternary
The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices unwind. c. sheet structures unfold. d. tertiary structure is changed. e. quaternary structures disassemble.
a 3d structure of protein with acces number of P02008 at uniprot database.
Hundreds of thousands of proteins have been discovered inliving organisms. Yet, as astonishing as this diversity is,these molecules constitute only a small fraction of thosethat are possible. Calculate the total number of possibledecapeptides (molecules with 10 amino acid residues linkedby peptide bonds) that could be synthesized from the 20standard amino acids. If you were to spend 5 minutes writing out the molecular structure of each possible decapeptide,how long would the task take?
Describe the two types of secondary structure apolypeptide can attain. Which proteins can achievequaternary structure? Which protein structure(s) are alteredby denaturation?
Biochemists talk about protein structure at four distinct levels: primary, secondary, tertiary and quaternary structure. Below are depictions of each of these levels of protein structure. For each image, match the term and the written description of the level of protein structure that the image depicts. Drag the appropriate items to their respective bins.
Most proteins require molecular chaperones toassist in their correct folding. How do you suppose thechaperones themselves manage to fold correctly?
Which two types of bonding are in the 1ubq (Ubiquitin)? Explain your choices. a) Hydrogen bonding b) Ionic bonding c) Covalent bonding d) Disulfide bonding