correct or incorrect. CORRECT INCORRECT Proteins in a primary structure consist of a simple polypeptide chain. Interactions between the R groups in amino acids form tertiary structure. Secondary structures are formed by multiple polypeptide chains The two types of secondary structures are the alpha and beta pleated sheets

correct or incorrect. CORRECT INCORRECT Proteins in a primary structure consist of a simple polypeptide chain. Interactions between the R groups in amino acids form tertiary structure. Secondary structures are formed by multiple polypeptide chains The two types of secondary structures are the alpha and beta pleated sheets

Biology (MindTap Course List)

11th Edition

ISBN:9781337392938

Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Publisher:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Chapter3: The Chemistry Of Life: Organic Compounds

Section: Chapter Questions

Problem 9TYU: Which of the following levels of protein structure may be affected by hydrogen bonding? (a) primary...

See similar textbooks

Similar questions

Which of the following levels of protein structure may be affected by hydrogen bonding? (a) primary and secondary (b) primary and tertiary (c) secondary, tertiary, and quaternary (d) primary, secondary, and tertiary (e) primary, secondary, tertiary, and quaternary
Describe the two types of secondary structure apolypeptide can attain. Which proteins can achievequaternary structure? Which protein structure(s) are alteredby denaturation?
There are four levels of protein structures. Name those four levels and briefly describe them
Among the many different biological functions of proteins, identify and describe two (2) general functions. Explain how theprotein structure relates to these functions. Cite a particular protein that exhibits each function you have described and give the unique features of its primary, secondary, tertiary, and quaternary (if applicable) structures.
Which level(s) of protein structure result(s) from non-covalent interactions involving both backbone groups and side chains? (Select all that apply!) a) Primary b) Secondary c) Tertiary d) Quaternary
Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
What level of protein structure is determined by the following:(a) Peptide bonds between amino acids?(b) Hydrogen bonds between backbone carbonyl oxygen atoms and hydrogen atoms attached to backbone nitrogen atoms?(c) R group interactions that may involve Van der Waalsforces, ionic interactions, or hydrogen bonds?
Indicate the level(s) of protein structure to which each of thefollowing contributes:a. amino acid sequenceb. b-pleated sheetc. hydrogen bondd. disulfide bond
Aquaporins are proteins embedded in the plasmamembrane that allow water molecules to move betweenthe extracellular matrix and the intracellular space.Based on its function and location, describe the keyfeatures of the protein’s shape and the chemicalcharacteristics of its amino acids.
Protein Structure Describe the four levels of protein structure: Primary, secondary, tertiary, and quarternary.
Indicate the level(s) of protein structure to which each of the following contributes: a. amino acid sequence b. β-pleated sheet c. hydrogen bond d. disulfide bond
Would you expect a carboxylic acid group within the waterfree interior of a protein to have a higher or lower Kathan itwould have if it occurred on the protein’s surface, where itis hydrated?