Answered: A human somatic cell has autosome(s)…

Science

Biology

A human somatic cell has autosome(s) and sex chromosomeſs). 44;2 2;44 22;1 1;22

Curren'S Math For Meds: Dosages & Sol

11th Edition

ISBN:9781305143531

Author:CURREN

Publisher:CURREN

Chapter16: Adult And Pediatric Dosages Based On Body Surface Area

Section: Chapter Questions

Problem 17SST

See similar textbooks

Related questions

Q: In class, we talked about flow cytometry which allows scientists to determine what stage of the cell…

A: Cdc25 is a phosphatase enzyme having dual specificity that is they can act on serine/threonine as…

Q: Which statements are true for mitosis? Group of answer choices (pick all that apply) 1.…

A: Answer. Mitosis is a type of cell division in which two daughter cells are produced having the same…

Q: 1. Mitosis Meiosis I Meiosis II Prophase Metaphase Anaphase

Q: sex-chromosome mosaicism? Based on what you know about the cell cycle, when and how may this…

A: The majority of the people consist of 46(forty-six) chromosomes in each of the cells. However, two…

Q: 23

A: This double stranded human DNA model was proposed by JAMES WATSON and FRANCIS CRICK. DNA consists of…

Q: If a cell at metaphase of mitosis contains 32 sister chromatids, how many chromosomes will be…

A: Metaphase is the third phase in mitosis in which the replication of chromosomes occurs in the…

Q: During interphase, Question options: DNA is replicated since it roughly doubles from start to…

A: INTRODUCTION Interphase is the phase in the longest phase of the cell cycle which includes G1, S AND…

Q: The process of mitosis (select all that apply) Group of answer choices 1. occurs in somatic cells…

A: As we know all cells are originated from pre-existing cells. So, to form new cell , cell division is…

Q: A somatic cell has the genotype DdEe. All chromosomes in this organism are metacentric. Show…

A: We are authorized to answer only one question at a time, since you have not mentioned which question…

Q: During interphase of the cell cycle, the chromosomes (DNA mass) of a cell _________. decreases…

A: Cell cycle refers to the series of events that take place in the division of a single cell into two…

Q: How many number of histone proteins present in a nucleosome? 4 6 9.

A: The nucleosome is the basic structural unit of DNA packaging in eukaryotes and represents a segment…

Q: The somatic cell of a sheep contains 54 chromosomes54 chromosomes (2?=54).(2⁢n=54). How many…

A: Somatic Cell -- Somatic cell is derived from a Greek word soma = body . Definition - A somatic cell…

Q: In general, are somatic cells genetically identical? Why or why not?

A: Answer is 2.) no - they come from mitosis.

Q: let's imagine a giraffe whose diploid is 30. 1)Under what circumstances would the giraffe go through…

A: 2n = 30 Mitosis performed under following circumstances - development , growth , replacement…

Q: What is the final result of mitosis in a human A) nearly genetically identical 2n somatic cells B)…

A: Mitosis: It is the process in which newly replicated chromosomes equally divided into two daughter…

Q: The human keratin 14 gene is found on chromosome 17. How many copies of the keratin 14 gene does a…

A: The human keratin-14 gene is located on the chromosome number 17. The human somatic cell (body cell)…

Q: Which of the following counts most closely represents the number of cells in the different stages in…

A: The cell cycle involves the interphase (resting phase) and mitosis phase(cell division phase).…

Q: Which statements are true for mitosis? Select all that apply: 1. produces identical daughter…

A: Cells are physical units of life. Cell organelles assist the cell functions and its survival. Cells…

Q: Highlights the important events in cell cycle (mitosis and Meiosis). 2. List down the nucleotides in…

A: All over the world, we can see various types of organisms. All of them have originated from a single…

Q: Select the FOUR statements below that describe the process of mitosis. used for growth, repair,…

A: Mitosis is a type of cell division where each of the daughter cells contain same number of…

Q: A group of cells is assayed for DNA content immediately following mitosis and is found to have an…

A: Mitosis is the process in which identical copy of a cell is made and is plain cell division and is…

Q: 1.Nucleosomes bind DNA so tightly that they cannot move from the positions where they are first…

A: Eukaryotic chromosome mainly consists of DNA, histone protein complex, some RNA and non histone…

Q: role of microtubles in mitosis in eukaryotic cells?

A: Microtubules are hollow tube like structures which are the part of cytoskeleton of a cell. They are…

Q: A Common Wombat has 14 chromosomes in one of its somatic (nonreproductive) cells. One of these…

Q: Do cells undergoing mitosis have homologous pairs? Why/why not?

A: Mitosis is the type of cell division which is responsible for the formation of two daughter cells…

Q: How many sister chromatids per chromosome in G2 of the cell cycle? Group of answer choices

A: The cell cycle is a series of cyclic events that takes place during cell division. Phases of the…

Q: Which of the following statements are true regarding mitosis in humans? (Check all that apply)…

A: Cell division is a systematic sequence of events that involves the growth and division of the cell…

Q: Human somatic cells have 46 chromosomes. How many chromosomes are present in human cells undergoing…

A: Meiosis refers to the cell division that characterized by the reductional division of the cells. In…

Q: Which of the following is unique to mitosis and not a part of meiosis? Question 10 options:…

A: Introduction : Cell division refers to a process by which a parent cell divides to give rise to…

Q: A crayfish strain became triploid while kept in a pet store. Pet owners released these crayfish into…

A: The order of cell cycle phase is G1→S→M In G 1 phase, the cell synthesizes takes place and In S…

Q: Growth Rate of Rapidly Dividing Human Liver Cell Time (hours) Number of cells 0 1 10 2 20 4 30 8 40…

A: according to the given data , in each 10 hours cell undergoes mitotic division and gives two…

Q: Draw EACH stage of mitosis and for EACH stage, describe a possible mutation/problem that will affect…

A: Mitosis is a type of of cell division that results in the generation of 2 daughter cells with…

Q: Fill in the table below with information regarding the cell cycle. Cell cycle stage Main events…

A: A cell cycle is a chain of events that takes place in a cell as it grows and divides. A cell spends…

Q: Sally took her dog Chester to the vet for some routine blood work, and asked the vet how many…

A: As we know all cells are originated from pre-existing cells. So, to form new cell , cell division is…

Q: Draw the metaphase 1 and anaphase 1.

A: Given,There are 9 pairs of chromosomes which undergoes mitosis and meiosis 1. After mitosis,2 cells…

Q: In regards to MITOSIS, give the order of the following events in terms of chromosome number.…

A: The cell division is the process that involves production of two or four daughter cells from a…

Q: A killer whale (orca) cell has 22 pair of chromosomes in G1. What is the total number of chromosomes…

A: The answer is 22. Meiosis is a process during which cell chromosomes decreases.It a division…

Q: When do sister chromatids separate in meosis? Question 30 options: Metaphase II Prophase II…

A: Cell division is a process in which a cell divides to form new cells. There are two types of cell…

Q: Pairs of homologous chromosomes separate during the following stage of cell division Select one: a.…

A: Chromosomes are the basic blueprint of any organism. All the proteins that will be expressed are…

Q: Which of the following statements regarding the cell cycle control system are true? (choose all…

A: The cell cycle is the cascade of events in series which involves cell growth, its division and…

Q: Somatic cells from two different people usually contain ____________________. identical RNA…

A: A somatic cell, or vegetal cell, is any biological cell forming the body of a multicellular organism…

Q: human cell has 46 total (23 pairs of) chromosomes. Following mitosis, the daughter cells would each…

A: Given: A human cell has 46 total (23 pairs of) chromosomes. The two types of cell division are:…

Q: For each stage of the cell cycle and mitosis, identify whether there are 46 or 92 chromosomes in a…

A: Mitosis is the cell division process in which one diploid (2n) mother cell divides and produce two…

Q: The purpose of mitosis in human cells is for the production of two diploid, _________________ cells.

A: Cell division is a metabolic phenomenon takes place Inside the cell in which parent cell undergo…

Q: Normal events in mitosis gives rise to daughter cells with exactly the same chromosome number and…

A: Mitosis is a process through which a cell divides and the daughter cells formed have the same ploidy…

Q: sperm of Panthera leo contains 19 chromosomes, which of the following is/are true about somatic…

A: The animal body is made up of cells which is a structural and functional unit of life. Every cell…

Q: Match the description to the correct phase of interphase. DNA is copied. The centrosomes…

A: The correct sequence for the match is 4) S 2) G1 1) G0 3) G2

Q: A panel of cell lines was created by human–mouse somatic-cell hybridization. Each line was examined…

A: Beadle and Tatum proposed one gene one enzyme hypothesis according to which a particular gene is…

Q: Human Somatic (non reproductive) cells have 46 chromosomes organized into 23 pairs. A human somatic…

A: Cells are the basic structural and Functional Unit of Life. Consequently, cell division is one of…

Q: A cell has 24 as its diploid number. At the end of Mitosis, this cell will split into how many…

A: Mitosis: It is called as Equational division, in this the cell divides into equal daughter cells,…

Concept explainers

Oogenesis

The formation of the ovum (mature female gamete) from undifferentiated germ cells is called oogenesis. This process takes place in the ovaries (female gonads). Oogenesis consists of three stages known as the multiplication phase, growth phase, and maturation phase.

Cell Division

Cell division involves the formation of new daughter cells from the parent cells. It is a part of the cell cycle that takes place in both prokaryotic and eukaryotic organisms. Cell division is required for three main reasons:

Question

A human somatic cell has autosome(s) and sex chromosomeſs). 44;2 2;44 22;1 1;22

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step 3

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

Why is 26 incorrect
Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
Somatic cells of the red fox, Vulpes vulpes, normally have 38 chromosomes. What is the number of chromosomes present in the nucleus during prophase II? 95 76 57 38 19
3738: The lungs are composed of tiny sacs that fill with air during breathing process. How does this tissue help the lungs do its function? It allows the lungs to produce more blood. It allows muscles to open and close them. It allows air to contact a large surface. It allows the lung to pump the air. :)In response to critically low nutrient levels, yeast cells often enter into a dormant, non-dividing state. This state allows yeast cells to survive until nutrient levels are restored, at which point the cells typically re-enter the cell cycle. Based on the information above, critically low nutrient levels caused yeast cells to ________. transition to meiosis transition to G1 phase to G0 phase transition from G0 phase to G1 phase transition to mitosis
True or false: A somatic cell mutation may be passed on to offspring.
What effect does colchicine have on the percentage of cells in EACH of the stages of mitosis?
1. Hyperproliferation or cell cycle arrest; cell cycle arrest or accumulation of dna; hyperproliferation or growth stress increase or decrease
IS Ki-67 protein is a cellular marker for proliferation, and during interphase, it can be exclusively detected by immunohistochemistry within the cytoplasm, but it is absent in quiescent cells (G0) ?
What would happen if anaphase proceeded even though the sister chromatids were not properly attached to their respective microtubules and lined up at the metaphase plate?
Describe how the duplicated bacterial chromosomes are distributed into new daughter cells without the direction of the mitotic spindle.
What is mitosis dependent
31. “Wnt”is a regulatory factor that regulate myogenic stem cell proliferation? True False