Chapter5: Phlebotomy Equipment
Section: Chapter Questions
Problem 1.2E
Related questions
Question
Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:
1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG
2. GPYFGDEPLDVHDEPEEG
3. PHLLSAWKGMEGVGKSQSFAALIVILA
Of the three, which one would migrate most slowly during chromatography through:
(a) an ion-exchange resin, beads coated with positively charged groups?
(b) an ion-exchange resin, beads coated with negatively charged groups?
(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?
(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?
Expert Solution
This question has been solved!
Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.
This is a popular solution!
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.Recommended textbooks for you