Answered: Denaturation of proteins results in *…

Denaturation of proteins results in * Disruption of primary structure Breakdown of peptide bonds Unfolding of protein chains O All of them

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter3: Biological Molecules: The Carbon Compounds Of Life

Section: Chapter Questions

Problem 8TYK: The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices...

See similar textbooks

Related questions

Q: Select all of the molecules that are made by dehydration synthesis. O peptides disaccharides…

A: Option 1,2,3,4 are correct. - dehydration synthesis is a chemical reaction where loss of water…

Q: Collagen is a fibrous protein which involves interactions between multiple helixes. Ohas a highly…

A: Collagen is a structural protein found naturally in humans and animals. It constitutes upto 30% of…

Q: The linear sequence of amino acids within of protein protein structure. a is an example tertiary…

A: Primary protein structure is a simplest form of protein structure. It is the linear sequence of…

Q: There is a "primary driving force" behind protein folding (to form tertiary structure). This driving…

A: Proteins are the monomers of amino acids that have a chiral or an alpha carbon with all four groups…

Q: Which of the following statements is not true about protein folding ? Protein folding is a process…

A: The folding of Protein is an important cellular process that occurs in the Endoplasmic reticulum.…

Q: A denatured protein has lost its _______ .a. hydrogen bondsb. shapec. functiond. all of the above

A: Proteins are complex molecules that are composed of amino acids as their building blocks. Proteins…

Q: How is the secondary structure of a protein stabilized?a) Van der wall forcesb) Hydrogen bondingc)…

A: Protein is a complex macromolecule that is composed of amino acids. The building blocks of protein…

Q: A ________ is a portion of protein with a particular structure andfunction.a. peptide bondb.…

A: Protein is a macronutrient that is essential to building muscle mass.

Q: An alpha-helical structure within a protein is stabilized mostly by O hydrophobic interactions. O…

A: The primary structure of the protein consists of a linear chain of amino acids linked by the peptide…

Q: 11. Amino acids in a protein are joined by: 1. Zwitterions 2. Hydrogen bonds 3. Peptide bonds 4. Van…

A: Amino acids are the building blocks of proteins. Amino acids are the organic molecules that are made…

Q: Fill in the following with the specific bond(s): Maintain(s)the helical structure of many…

A: Proteins are polymers of amino acids where the consecutive amino acids are attached by a special…

Q: macromolecules monomers Linking 'bonds' Fill in the boxes Using info given as clues Amino Acids…

A: Biomolecules are organic molecules found inside living system.

Q: DNA is composed of ___________, which are attached to each other by _______________ bonds. A) amino…

A: The biochemical material that is carried from the preceding generation to the succeeding generation…

Q: Which one of the following statements about hydrogen bonds is FALSE? O hydrogen bonds are the…

A: Hydrogen bonds are intermolecular forces that act between two molecules. These bonds are formed when…

Q: Which chemical bond connects nucleotides in RNA molecule? peptide bond O hydrogen bond O…

A: It is involved in the synthesis of proteins, carrying instructions from DNA and instructions for…

Q: The red dotted lines represent O peptide bonds hydrogen bonds O covalent bonds O hydrogen bonds…

A: A motif in protein structure refers to a chain-like biological structure made up of connectivity…

Q: Proteins often have regions that show specific, coherent patterns of folding or function. These…

A: Proteins are polymers of amino acids linked by peptide or amide bond between carboxyl group of one…

Q: Bond formation in polysaccharides and polypeptides is accompaniedby the removal of aa. hydrogen…

A: In polysaccharides we have a glycosidic bond and in polypeptides we have peptide or amide bond.

Q: O Primary structure ultimately dictates the structure and function of a protein

Q: Which of the following statements about proteins is false? Proteins are sometimes conjugated with…

A: Proteins are one of the most important biomolecules in any living body. They are basically…

Q: This level of protein structure involves regular patterns within a protein chain held by hydrogen…

A: The proteins are the long polypeptide chain of the amino acids, which are joined by the peptide…

Q: Proteins are synthesized by linking amino acids with ___________bonds.a. disulfideb. glycosidicc.…

A: Proteins are made up of amino acids.

Q: Tertiary structure of a protein describes * The order of amino acids Location of disulphide bonds O…

A: Proteins are structurally organized into four levels and they are primary structure, secondary…

Q: The protein structural level that could be least affected by hydrogen bond disruption is the A.…

A: Proteins are big, complex molecules that serve a variety of important tasks in the human body.…

Q: Proteins occurring in the b-pleated sheet structure Multiple Choice are relatively inelastic.…

A: INTRODUCTION Beta pleated structure of protein This contain beta strands held together by two or…

Q: Which of the following types of bonds are present in the primary structures of proteins? O Hydrogen…

A: Proteins are composed of twenty standard amino acids attached together through amide bonds. These…

Q: Which statement about the structure of proteins is correct? O The a-helix and b-sheet are two common…

A: Structure of protein:- Primary- is the sequence of amino acid or a polypeptide chain ( therefore…

Q: What happens when a protein is denatured? The chemical bonds are not impacted, but the protein shape…

Q: have primary, secondary, tertiary, and sometimes quaternary structure can increase the rate of…

A: Ans:- Option (C) is right -----Are chemically changed during thier participation in chemical…

Q: n the secondary structure, proteins make (A) helices and (B) pleated sheets. These are created from…

A: Proteins are macromolecules formed by amino acids.A total of 20 different amino acids exist in…

Q: Which of the following is incorrect? Oa. None; all the other choices are correct O b. Disulfide…

A: Disulfide bonds are the bonds that are formed between two sulfhydryl groups. It is a covalent bond…

Q: A protein that has lost its tertiary structure and is non-functional is called demoralized. O True O…

A: “Since you have asked multiple questions, we will solve the first question for you. If you want any…

Q: ge Bonds formed by equal sharing of a pair of covalent electrons are called bonds because there is a…

A: A chemical bond is a lasting attraction between atoms , ions, or molecules which allows chemical…

Q: Which of the following statement(s) about proteins is true?

A: Proteins are polymers of amino acid. Denaturation of protein means loss of quaternary, tertiary and…

Q: What chemical bond maintains alpha helixes of the proteins? O Disulfide bond O lonic bonds O…

A: Proteins are the polymers of amino acids connected to each other by peptide bond.

Q: A coiled peptide chain held in place by hydrogen bonding between peptide bonds in the same chain is…

A: Proteins are the biomolecules that are building blocks of the body. Proteins are made up of amino…

Q: Proteins are the most structurally sophisticated molecules known, consistent with their diverse…

Q: The monomers that make up proteins are called_________.a. nucleotidesb. disaccharidesc. amino…

A: Proteins are the polypeptide chain, which folds into a three dimensional (3D) structure to…

Q: 7) Which level of protein structure is when the protein is actually capable of being functional?…

A: Proteins are macro-biomolecules made up of amino acids subunits joined by peptide bonds.

Q: I. Below is a concept map to fill in to help you organize the key concepts of proteins. Proteins…

A: Nutrients required by the body are classified as macronutrients and micronutrients. Macronutrients…

Q: the linear sequence of amino acids in a polypeptide chain is referred to as a proteins _________…

A: Protein is a complex molecular structure. It is greatly responsible for the majority of the…

Q: Denaturation is the loss of protein function from structuralchange or chemical reaction. At what…

A: Proteins have different levels of organization, which, when combined, give the functional protein.…

Q: You disrupt all ionic bonds in a single protein molecule. Which level of structure will be directly…

A: Proteins are made from chains of polypeptide . A polypeptide chain is defined as chain containing a…

Q: The function of a protein depends on the protein's ______

A: Protein is a biopolymer composed of amino acids linked by a peptide bonds. There are 20 different…

Q: Vhich of the following statements is true about protein classes? * On hydrolysis, simple proteins…

A: Protein is a major biomolecule and it is made of amino acids that link together via peptide bonds.…

Q: Identify and describe the polymer structures of a protein that constitutes its unique conformation.

A: The building blocks of cell structures and motors of cellular activities are proteins. The protein's…

Q: What is the key driving force for forming stable 3D structures of proteins (e.g., the coronavirus…

A: 3-D structures of proteins are the tertiary and quaternary protein structures that are the final…

Q: The folded conformation of proteins can be stabilized by 2 the formation of a salt bridge between…

A: Since you have posted multiple questions, we will answer one question for you. If you want answer…

Q: Proteins are always functional as single protein fibers with nothing attached can never form…

A: Dynamics and conformational changes of protein allow them act as nonscale biological machine in…

Question

Denaturation of proteins results in *
Disruption of primary structure
Breakdown of peptide bonds
Unfolding of protein chains
All of them

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

Which of the following levels of protein structure may be affected by hydrogen bonding? (a) primary and secondary (b) primary and tertiary (c) secondary, tertiary, and quaternary (d) primary, secondary, and tertiary (e) primary, secondary, tertiary, and quaternary
Below is the structure of glycine. Draw a tripeptide composed exclusively of glycine. Label the N-terminus and C-terminus. Draw a box around the peptide bonds.
Describe the four levels of protein structure. How do a proteins side groups influence its interactions with other substances? What happens when a protein is denatured?
What maintains the secondary structure of protein: A) peptide bond. B) Hydrogen bonds between the amino group of one peptide bond and the carboxyl group of another peptide bond. C) Hydrogen bonds between the R group of one amino acid and the carboxyl group og another peptide bond. D) disulfide bonds. E) Hydrophobic interactions.
Describe how peptide bonds, hydrogen bonds, ionic bonds, disulfide bridges, and noncovalent interactions (van der Waals forces and the hydrophobic effect) define a protein’s four levels of structure.
Protein Structure Describe the four levels of protein structure: Primary, secondary, tertiary, and quarternary.
Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
What level of protein structure is least likely to be affected if a protein's environment experiences a shift in pH below its optimal range? A. Quaternary B. Secondary C. Primary D. Tertiary
Proteins often have regions that show specific, coherent patterns of folding or function. These regions are called: a. domains. b.oligomers. c. peptides. d. sites. e. subunits.
Hydrogen bonds and hydrochloric interactions play important roles in stabilizing and organizing biological macromolecules. Describe how Hydrogen bonds and hydrochloric interactions affects the form and function of proteins.
Proteins in tertiary and quaternary structure are held together by ___ between ___.
A peptide has the sequence: glu-trp-ser-gly-leu-lys-pro-gly What is the net charge of the molecule at pH 3,8,11 (only two side chain are ionizable).