Part of the backbone of a tripeptide is shown. Modify the backbone to properly show a tripeptide, then add side chains and hydrogen atoms to show Gly-Phe-Tyr in its neutral zwitterionic form. Add hydrogens using the condensed hydroger tool in the More menu. H co0 H,N - H

Part of the backbone of a tripeptide is shown. Modify the backbone to properly show a tripeptide, then add side chains and hydrogen atoms to show Gly-Phe-Tyr in its neutral zwitterionic form. Add hydrogens using the condensed hydroger tool in the More menu. H co0 H,N - H

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter3: Biological Molecules: The Carbon Compounds Of Life

Section: Chapter Questions

Problem 8TYK: The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices...

See similar textbooks

Related questions

Q: Urea will always completely disrupt structure of proteins. (Select all that apply!) O Primary…

A: Protein is a macromolecule that is made up of amino acid building blocks. Normally, the association…

Q: Figure 2 shows a reaction between two monomers that produces a disaccharide. a Figure 2 H. XXXX HH…

A: Carbohydrates are macromolecules composed of carbon, hydrogen, and oxygen. Carbohydrates are…

Q: Draw on a piece of paper, take a picture and upload the tripeptide: Gly-Phe-Ala How many…

A: Two to fifty amino acids combine to form a peptide. If more than 50 amino acids are present in a…

Q: draw the primary structure of the polypeptide at physiological pH range of 7.35-7.45 put the name of…

A: Polypeptides or peptides are composed of twenty standard amino acids attached together via peptide…

Q: Type of Bond:

A: The structure of a protein has four levels of organization: primary, secondary, tertiary, and…

Q: | Conc. H,SO, a-naphthol |(*) Conc. H,S0, acetic anhydride Orcinol, FeCl, HCI A () c (*) (-)…

A: This experiment shows testing of a mixture of carbohydrate/sugar In Step 1: Reagent used in Conc…

Q: Would you expect lipids to be soluble or insoluble in each of the following solvents? a.…

A: Lipids are molecules that contain hydrocarbons and make up of the building blocks of the structure…

Q: The bond between 2 amino acids ● A. glycosidic bond OB. N-glycosyl linkage ● c. peptide bond OD.…

A: Introduction :- Proteins are made up of substances called amino acids. Proteins and amino acids are…

Q: he disulfide bond— is a hydrogen bond in which the sulfhydryl group is the hydrogen donor.…

A: A disulfide bond, also called an S-S bond, or disulfide bridge, is a covalent bond derived from two…

Q: Describe the type of bonds and the atoms those bonds are between that define the tail as saturated…

A: Saturated fat is a type of dietary fat. It is one of the unhealthy fats, along with trans fat.…

Q: Which of the following factors is responsible for the denaturation of proteins? * Oa) Heat Ob)…

A: In the process of denaturation, the protein losses its native state. This occurs because of the…

Q: Write the full name of amino acids, from N-terminus to C-terminus, after hydrolysis of the following…

A: Note: Since you have asked multiple questions, we will solve the first (the topmost) question for…

Q: nonpolar Basic, Group hydrophobic neutral а. CH2 „CH CHS CH3 b. с. CH2 CH2 CH2 CH2 NHs* d. CH2 OH

A: A hydrophilic molecule or functional group is an entity that is attracted to water molecules and…

Q: Beta-sheets form through ___ between ___. a hydrogen bonds; groups on the polypeptide backbone…

A: Beta sheets consist of beta strands connected laterally by at least two or three backbone hydrogen…

Q: CH, CH, The dark pink puzzle pieces show O nitrogenous bases. ribose molecules. O deoxyribose…

A: Answer is deoxyribose molecule

Q: H H |H I peptide chains H Type of bond Choose ペーUーエアー O=U 1.

A: Since you have asked multiple questions, we will solve the first question for you. If you want any…

Q: Analyze the image that is given below and focus on the red arrow to be able to answer the questions…

A: Since you have posted multiple questions, we will answer first one for you. If you want answers for…

Q: What kind of hydroxyl groups do carbohydrates have? (More than one answer is possible.) A.…

A: Carbohydrates are made up of C, H, O. Carbohydrates are the polyhydroxy aldehyde and ketone.…

Q: Formation of disulfide bonds can contribute to ______ structure. (Select all that apply!)…

A: The formation of disulfide bonds occurs during the folding of proteins in the endoplasmic reticulum…

Q: Which molecules is useful for holding proteins and fats in suspension with eachother? (Select all…

A: The protein-lipid interactions play important role in the structure and function of biological…

Q: Nitrogenous bases in nucleic acids can either be a purine or a pyrimidine. Fill in the chart below…

A: Purine is an organic compound that consists of a pyrimidine ring fused to an imidazole ring.…

Q: Bond formation in polysaccharides and polypeptides is accompaniedby the removal of aa. hydrogen…

A: In polysaccharides we have a glycosidic bond and in polypeptides we have peptide or amide bond.

Q: At which pH would the structure shown be predominate? H₂N-CH- - H OpH 1 pH 3 pH 8 pH 11 0 0

A: Glycine has the simplest structure among all the amino acids. This side chain of amino acid has most…

Q: Classify the following compounds according to type of lipids. * SIMPLE COMPLEX DERIVED 1mide…

Q: For numbers 21-22, refer to the image given below. CH3CH2-0-H + H* 21. What type of bond will be…

A: Alcohols, just like water, are both weak bases and weak acids. The acid ionization constant of…

Q: Starch undergoes decomposition under high concentration of Select one: a. base b. acid c. iodine…

A: Starch is a form of complex carbohydrate made up of two polymers, namely amylose (linear) and…

Q: Proteins occurring in the b-pleated sheet structure Multiple Choice are relatively inelastic.…

A: INTRODUCTION Beta pleated structure of protein This contain beta strands held together by two or…

Q: Watch this video (http://openstaxcollege.org/l/disaccharide) to observe the formation of a…

A: Glycosidic bonds are formed between the sugar moieties. It is a covalent bond, which results in the…

Q: draw the primary structure of the polypeptide at physiological pH range of 7.35-7.45 put the name of…

A: Proteins are unbranched polymers constructed from 20 standard α-amino acids. They have four levels…

Q: Identify the IMF that would form between the side chains of: Asn and Thr O Hydrogen bonds…

A: Answer is option a.) hydrogen bonds.

Q: Multiple choice: Which of the following usually dissolves well in water? Select one or more: a.…

A: Water solubility is the measure of the amount of chemical substance that can dissolve in water at a…

Q: Define the following terms:a. aldol condensationb. a-carbonc. hydrophobic amino acidd. secondary…

A: Introduction: Amino acids are organic compounds with amino and carboxyl functional groups and a…

Q: Rg thế chârt above, what type of molecules (carb, lipjd, nucleic acid or protein) are these? 12…

A: Macromolecules are large biomolecules such as proteins, carbohydrates, lipids, and nucleic acids.…

Q: Below is a general outline of a soap molecule. Indicate on the outline the area that is expected to…

A: A fatty acid is a carboxylic acid with a long hydrophobic aliphatic hydrocarbon chain and soap is…

Q: Shown below is the titration curve for the amino acid glycine (side chain -H). What is the…

A: An amino group and an acid group are present in organic molecules called amino acids.…

Q: Arrange in chronological order the steps on how a hydrocolloid is formed. Particle swelling…

A: Hydrocolloids are hydrophilic polysaccharides of high molecular weight extracted from plants and…

Q: A linear tripeptide has—

A: Proteins are polymers made of individual building blocks called amino acids. Amino acids are…

Q: X. Glycosidic linkage in carbohydrates are form as a result of hydrolysis Y On the other hand,…

A: Biological macromolecules are the big sized molecule that are required by body and are metabolized…

Q: 2. Circle & Name functional groups -C-N, H. CH2 но CH H,C CH, HICICI

A: Amino acids: It is considered the building block of life as a polymer chain of amino acids forms a…

Q: Which of the following interactions will be most UNAFFECTED at very high salt concentration or at…

A: Three dimensional structure of the proteins are stabilized by the covalent as well as non-covalent…

Q: The given dipeptide is Ala-Ser. Indicate the charge state for each structure at the given pH by…

A: At pH=1 (pH<7), there is an excess of H+ ions in the aqueous solutions. So, the COO-n group…

Q: Analyze the image that is given below and focus on the yellow arrow to be able to answer the…

A: Proteins are polymers of Aminoacids which are joined by peptide bond. Structure of protein is…

Q: draw the primary structure of the polypeptide at physiological pH range of 7.35-7.45 put the name of…

A: Polypeptides are composed of twenty standard amino acids. These twenty standard amino acids differ…

Q: reaction that takes place (substance where reaction occur) Lipid Oxidation Browning Protein…

A: The question is about the information regarding the terminologies lipid oxidation, browning and…

Q: Milligram of base required to completely hydrolyze & neutralize 1 g of triglyceride/fat sample O…

A: Saponification is described as an hydration reaction, where ester bonds between fatty acids and…

Q: Define the following terms:a. optical isomerb. isoelectric pointc. peptide bondd. disulfide bridgee.…

A: Proteins are organic molecules that are present in living organisms. They serve a wide range of…

Q: Summary Chart Macromolecule Monomer Polymers Bonds Functional Groups Examples CH2OH CH2OH он -…

A: Macromolecules are the molecules of high molecular masses. These are composed numerous small…

Q: Which of the following alters proteins and membranes? Alcohols O lodine O All other choices O…

A: Many critical roles in the body are performed by certain complex molecules called proteins. For the…

Q: Where is hydrogen bonding observed in proteins? Between one part of the protein backbone and another…

A: Proteins are the biomolecules that are formed from amino acids joined by peptide bonds. There are…

Question

O Attempt 2
Part of the backbone of a tripeptide is shown. Modify the backbone to properly show a tripeptide, then add side chains
and hydrogen atoms to show Gly-Phe-Tyr in its neutral zwitterionic form. Add hydrogens using the condensed hydrogen
tool in the More menu.
H,N
H
H.
Show All
Pablo Picasso.pdf
New Scan 2021-...pdf
MacBook Pro

Expert Solution

Step 1

The peptide is formed from amino acids. The amino acids are linked by peptide bonds formed due to the loss of a water molecule.

Trending now

This is a popular solution!

Step by step

Solved in 3 steps with 1 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.

Similar questions

The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices unwind. c. sheet structures unfold. d. tertiary structure is changed. e. quaternary structures disassemble.
Draw the structure of 2 five-mers (draw backbones with side chains shown as R groups) forming a beta sheetwith two anti-parallel beta strands. Indicate the hydrogen bonds present inthissecondary structure.
Only qno3m I think protein drawing has to show the bond interactions Onlyqno3 solve. I. Given a polypeptide below, answer the following questions: MAGGMIVIIGGMGCNSMVVVIIIGTSSCVIMEMMMIVKII Questions: 1. Enumerate all non-polar amino acids. (Provide the single letter and common name) 2. Enumerate polar amino acids include the acidic and basic types. (Provide the single letter and common name) 3. Illustrate the overall shape of the given polypeptide. Point out the specific side-chain interactions that could occur in this polypeptide by labelling the polypeptide. Defend your answer as to why your polypeptide should assume such final shape. Only accurate drawing need
Indicate the level(s) of protein structure to which each of thefollowing contributes:a. amino acid sequenceb. b-pleated sheetc. hydrogen bondd. disulfide bond
Please Answer numbers 1, 2 & 3 thank you 1. Which of the following intermolecular molecular forces of attraction is disrupted when a native protein is added with acetic acid? a. Hydrogen bond b. Peptide bond c. Disulfide bond d. Salt bridge e. van der Waals force 2. Suppose a protein sample with a fragment containing the following amino acid sequence is subjected to various chemical assay/tests. - Ala-Gly-Phe-Met-Cys- which of the following test will the sample be positive? a. Lead-sulfide test b. Hopkins cole's test c. Millon's test d. Xanthoproteic test 3. Suppose a protein sample with a fragment containing the following amino acid sequence is subjected to various chemical assay/tests. - Ala-Gly-Trp-Phe-Met-Cys- What is observed when the protein sample is subjected to Millon’s test? a. Violet interface b. Red precipitate/solution c. Brown/black precipitate d. Yelllow product e. No observable result
LLNSAMSRLYSLRSS 1.Assuming this sequnce is enitrely alpha helical what is the hydrogen bond donor to the carbonyl oxygen of Met6? 2.what amino acids in the sequnce above would most likely face the hydrophoic core od a protein? 3. at ph7 which amino acid side chain can form ionic bonds.
the DNA consists f 2 strnds hold together by which bond?
Show below is a polypeptide comprised of 3 α-helices and 5 β-sheets joined by randomcoil. Characterizetheforces that stabilize the tertiarystructure and draw the interacting side chains ofd) Cys Cys
Adenine, cytosine, guanine, and thymineare the four nitrogenous bases found inDNA. For each molecule, identify all of thenonhydrogen atoms that are required to bein the same plane.
Need both answer ASAP. 1.Draw the structure of pppUCGAP ribonucleic acid in the ionic form that would predominate at pH 7.0. 2.Draw the structure of ppTGACpp deoxyribonucleic acid in the ionic form that would predominate at pH 7.0.
Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
At given pH of 7 draw an amino acid or peptide and describe the certain secondary structures found (in terms of tertiary/quaternary structure) Repeat this process again for an amino acid or peptide at a pH of 4 and 12