Primary structure [ Choose ] Secondary structure [Choose ] Tertiary structure [ Choose ] Quarternary structure v [ Choose ] the coiling or folding of the chain, stabilized by hydrogen bonding :alpha helix or beta pleated sheet Three-dimensional shape stabilized by disulfide and hydrogen bondsnds Two or more polypeptide chains are associated to form functional molecule the unique sequence of amino acids forming the polypeptide

Primary structure [ Choose ] Secondary structure [Choose ] Tertiary structure [ Choose ] Quarternary structure v [ Choose ] the coiling or folding of the chain, stabilized by hydrogen bonding :alpha helix or beta pleated sheet Three-dimensional shape stabilized by disulfide and hydrogen bondsnds Two or more polypeptide chains are associated to form functional molecule the unique sequence of amino acids forming the polypeptide

Biology (MindTap Course List)

11th Edition

ISBN:9781337392938

Author:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Publisher:Eldra Solomon, Charles Martin, Diana W. Martin, Linda R. Berg

Chapter3: The Chemistry Of Life: Organic Compounds

Section: Chapter Questions

Problem 9TYU: Which of the following levels of protein structure may be affected by hydrogen bonding? (a) primary...

See similar textbooks

Similar questions

Which of the following levels of protein structure may be affected by hydrogen bonding? (a) primary and secondary (b) primary and tertiary (c) secondary, tertiary, and quaternary (d) primary, secondary, and tertiary (e) primary, secondary, tertiary, and quaternary
Describe the four levels of protein structure. How do a proteins side groups influence its interactions with other substances? What happens when a protein is denatured?
Regarding protein structure: Match each the following statements to the correct level of protein structure. A. Quaternary Structure B. Secondary Structure C. Tertiary Structure D. Primary Structure 1. Consists of a sequence of amino acids. 2. Involves the formation of peptide bonds 3. Includes the alpha helix and beta pleated sheets 4. Involves the hydrogen bonding at the peptide backbone. 5. Is formed by side chain interactions. 6. Bond types may include disulfide bridges. 7. May consist of more than one polypeptide chain. 8. Typically represents the fuctional protein structure.
Describe the four levels of protein structures. Include information about the bond between amino acids, and for the third level of protein structure, discuss the other types of bond found there. Make sure you include hydrogen bonds, ionic bonds, and an example of covalent bonding. Explain why not all proteins form a quaternary structure.
Which of the following statement about quaternary structure of protein is correct? Select one: a. Quaternary structure is a force between different polypeptides. b. Hydrogen bond is an only force found in quaternary structure. c. Quaternary structure contains one polypeptide. d. Quaternary structure is an unfolded form of protein.
Find a protein of your choice, choose a part of it (containing at least 30 amino acid residues), find the amino acid sequence (sequence in it), identify what functional groups the amino acid substitutes contain (carboxyl group and 2-position the Nitro group will form amide bonds, forming the covalent basic structure of the protein). What different interactions can occur between these functional groups? How will it relate to the spatial structure of the protein?
Discuss using your own words and illustrations the organisation of a protein, from its linear amino acid sequence, to its final three–dimensional configuration, which may include one or more polypeptides. Include what types of bonds help to stabilise each structural level, from primary through quaternary structure.
Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
Explain Four Levels of Protein Structure with examples and talk about the importance of each structure (Primary, Secondary, Tertiary, and Quaternary structure). With photos please
A protein has higher order structure. Which statement about higher order structure of proteins is true? Group of answer choices A protein's primary structure is its amino acid sequence. The quaternary structure of a protein is comprised of its alpha helices and beta pleated sheets. Polypeptide subunits combine to form a protein's tertiary structure. All previous answers None of these answers
Protein Concept Map Add these terms to your concept map should include these concepts and details: Structure (functional groups, shape); Monomer; Linkage; Properties; Functions; Key terms from the Partial List of Key Terms from the Minds Partial List of Key Terms essential amino acid amino acid side group/R-group peptide bond polypeptide receptor neurotransmitter hormone secondary structure tertiary structure quaternary structure fair test hydrophobic hydrophilic intermolecular force of attraction
The final 3-dimensional structure of a globular protein is defined by several types of structural units. Rank the following structural units in function of their complexity, starting from the bigger and more complex and ending with the smaller and less complex structural unit: Alpha helices, domains, peptide bonds, oligomers, reverse turns