Question 9 I am an alanine residue present in a peptide with defined secondary structure. I have and dihedral angles of 45° and -45°, respectively. What structure best defines my environment? O B-sheet O B-turn O Right handed a-helix O Left handed a-helix O These angles do not correspond to a well-defined secondary structure
Q: Doctor recommended a patient with coronary heart disease to use lipids that contain polyunsaturated…
A: Polyunsaturated fatty acids means fatty acid molecules with many double or triple bonds.…
Q: Choose the best answer for each blank. The pyruvate dehydrogenase (PDH) complex is regulated by the…
A: Glucose is oxidized during glycolysis and the end product (pyruvate) is converted to Acetyl CoA via…
Q: Considering that regulation most often occurs at irreversible steps in a biochemical pathway, which…
A: Enzymes are usually protein molecules which catalyze several biochemical reactions in our body…
Q: Some metabolic enzymes undergo large-scale conformational changes to prevent undesirable side…
A: Enzymes are high molecular-weight protein molecules that catalyse biochemical reactions. The…
Q: 2-phosphoglycerate ATP or acetyl CoA glucose ATP or NADH ADP ATP NADH ADP or acetyl CoA pyruvate…
A: Glycolysis is a process in which one molecule of glucose is converted into two molecule of pyruvate…
Q: true or false: Pyrimidine synthesis involves the use of a molecule of N10-formyl…
A: Pyrimidine is one of the bases required in the nucleotides formation.
Q: *One possible hereditary metabolic defect is the inability to synthesize the enzyme glycogen…
A: Hereditary metabolic defects are those diseases in which a non-functional gene variant whose…
Q: 1. Using Fischer Projection, draw each of the reaction. for the investment phase of Glycolyse 1…
A: Carbohydrates consumed in diet are oxidised via the glycolysis pathway. Carbohydrates are first…
Q: Hypo and hyperglycemia, causes and consequences
A: The major sugar present in the blood is known as blood sugar or glucose. It originates from the food…
Q: A major challenge to cells that are metabolizing amino acids is: A) changes in pH due to acidic and…
A: Amino acids are biomolecules that have an amino group a carboxyl group and a side group attached to…
Q: Tell how many ATPs result from from oxidative phosphorylation of one NADH; tell how many ATPs result…
A: Oxidative phosphorylation is oxygen dependent cellular process to generate energy in terms of ATPs…
Q: Describe the mechanism for moving acetyl-CoA produced in the mitochondrial matrix into the cytosol…
A: An enzyme called acetyl CoA carboxylase in the cytoplasm catalyzes the carboxylation of Acetyl CoA…
Q: Another biochemical study from another patient reveals a 100X increase in the KM value for the…
A: For a one-substrate enzyme catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Determine how many water molecules are used to completely oxidize Lignocerate (24:0) 8 10 014 011 9…
A: Fatty acids are long chain hydrocarbons with a carboxyl end. Glycogen is the storage form of…
Q: The mismatch DNA repair mechanism is based on the fact that: O a. O b. O C. O d. The parental DNA…
A: Mismatch repair is a process in which mismatched nucleotides present in the complementary paired…
Q: What is the principle of the Restriction Fragment Length Polymorphism (RFLP) in the diagnosis of…
A: RFLP can be used to diagnose various genetic disease .
Q: 2. Energetics of the electron transport. In the oxidative phase of oxidative phosphorylation,…
A: Standard change in Gibbs free energy (∆G'0 ) of redox reactions can be found, if we know the…
Q: LO43 Identify the levels at which gene expression can be regulated in prokaryotes and eukaryotes…
A: Gene regulation is the process of control of expression genes. This process occurs by several…
Q: Which of the following is a substrate from primase?
A: DNA/RNA are nucleic acids, the molecules responsible for carrying genetic information from one…
Q: Q2. Circle true or false for each stat ni bavlovni smyno sto siqmsxs n6 zi sbimsoqu 1) T F Oxygen…
A: Since you have posted multiple questions, we will provide the solution only to the first five…
Q: what is the name of the metabolite 1? what enzyme converts from metabolite 1 to 2 (E1)? what is the…
A: Given molecule (metabolite 1) consist of one ring structure, and one ribose-diphosphate group. The…
Q: At which temperature given does hemoglobin have a higher affinity for oxygen?
A: Hemoglobin is a protein that transports oxygen from lungs to tissues and CO2 from tissues to lungs.…
Q: In humans, apolipoprotein B48 is found on: A) Chylomicrons. OB) HDL. OC) IDL.
A: The apolipoprotein is a protein component of plasma lipoprotein that is capable of binding and…
Q: Questions 11-13- refer to the carbohydrate mannose (open chain and one anomeric ring configuration…
A: Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified as monosaccharides,…
Q: Which of the following is true about myoglobin and/or hemoglobin?nd a. The iron in hemoglobin is in…
A: Since you have posted multiple MCQ questions, we will provide the solution only to the first three…
Q: onsider the following tripeptide: Gly—Ala—Val What is the charge of the primary structure of…
A: Amino acid sequences are written with N-terminal amino acid on the left and C-terminal amino acid on…
Q: Which of the following statements about the TCA cycle is INCORRECT? O a. The TCA cycle can recover…
A: An inventive set of eight reactions makes up the TCA cycle. It is a crucial route that uses a…
Q: does BPG bind to deoxyhemoglobin only?why BPG does not bind to oxyhemoglobin? what is chemical…
A: Hemoglobin is a globular protein, ie it is roughly spherical. It is a tetramer of two types of…
Q: . a. Explain why the melting point of palmitic acid (16 carbons, no double bonds) is slightly lower…
A: Lipids are a chemically diverse group of biomolecules that have two things in common: low…
Q: One xylulose 5-phosphate, One glyceraldehyde 3-phosphate, One sedoheptulose 7-phosphate, 1…
A: After glucose enters the cell it is immediately phosphorylated into glucose 6-phosphate. Glucose…
Q: Eukaryotic RNA polymerase II is used to synthesize: a. rRNA O b. tRNA O C. O d. RNA from viral DNA O…
A: Transcription is the synthesis of RNA from DNA that is the process of copying the information of a…
Q: In TCA cycle, FADH2 is formed in reaction(s) catalyzed by a. Succinyl-CoA synthetase O b. Succinate…
A: In aerobic condition, pyruvate in the presence of pyruvate dehydrogenase complex produces Acetyl…
Q: Which of the following statements is correct about chemiosmosis? Select one: O a. it makes…
A: Electrons generated during the oxidation of carbohydrates are carried by electron carriers such as…
Q: Why are steps 4 and 5 essential to the operation of the PDH complex? They catalyze the synthesis of…
A: Pyruvate dehydrogenase (PDH) complex oxidizes pyruvate to acetyl-CoA and carbon dioxide. It happens…
Q: AG" for reaction A B = -10 kJ/mol AG" for reaction BC = -8 kJ/mol AG" for reaction CD = 5 kJ/mol AG"…
A: The standard free energy change (∆G°) of a chemical reaction is the free energy change at the…
Q: how do we name the bond between monomer B and monomer C
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula :…
Q: What is the dissociation equilibrium constant of a protein if the concentration of free ligand is…
A: Consider the following reaction: P + L ⇌k2k1 PL where P is the protein, L is the ligand and k1 and…
Q: In the initial step of the Q cycle, the electrons of QH2 (or ubiquinol) are transferred to: OA)…
A: The complex III of the electron transport chain ( Q-cytochrome c oxidoreductase) consists of three…
Q: Which of the following liver metabolic pathways are not normally active at the same time but are…
A: Cortisol : This is steroid hormone that increases blood glucose levels. it decreases glucose uptake…
Q: Efficascent Oil liniment formulation
A: Efficascent Oil liniments are oils that are topically applied to relieve muscle pain, joint pain,…
Q: draw a guanine nucleobase and label all possible H bond donor and H bond acceptor?
A: H bond donor are those groups containing a H bonded to a electronegative atom (F,O,N) and H bond…
Q: What are the components of cephalins? Glycerol Two fatty acids Phosphoric acid Serine All of the…
A: Lipids are a very important class of biological molecule. Lipids can be classified into 2…
Q: Positive and negative controls must be included in any immunoassay. Controls are always run before…
A: A variable is any quantity we can measure. In any experiment there are three variables:…
Q: what are the features which set the G protein family of receptors apart?
A: G protein-coupled receptors (GPCRs) are regarded as one of the most extensive families of validated…
Q: Urea is an ideal way to remove ammonia from the body because: OA) it does not affect the pH of…
A: Metabolism generates free ammonia.ammonia is toxic to cells so it must be eliminated from the cells…
Q: As a result of complete fasting for 3 days, a significant change in metabolism occurs. How will the…
A: Cells are machinery structures which carry out various complex controlled biochemical reactions in…
Q: An in vitro experiment used the isotope 14C-acetyl-CoA to identify 14C- oxaloacetate (OAA) as the…
A: Citric acid cycle - it is also called as Krebs cycle or the TCA cycle (tricarboxylic acid cycle)…
Q: OXIDATIVE PHOSPHORYLATION: 3A) Thoroughly explain the biological significance of NADH/H* and FADH2…
A: All life forms require energy. We obtain this energy from the food we eat. It is the highly reduced…
Q: What specific qualities of ATP make it a useful energy currency?
A: Adenine, different phosphate groups, and ribose sugar make up the chemical molecule known as ATP.…
Q: The key regulatory enzymes in glycolysis are: A) hexokinase, phosphofructokinase, and pyruvate…
A: In the anaerobic process of glycolysis, one glucose molecule is transformed into two pyruvate…
Step by step
Solved in 2 steps
- Amino acids have the generic structure seen below, where R represents different carbon-based side chains. Describe how the structure of amino acids allows them to be linked into long peptide chains to form proteins.The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices unwind. c. sheet structures unfold. d. tertiary structure is changed. e. quaternary structures disassemble.Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
- Which of the following peptides is more likely to take up an α-helical structure, and why?(a) LKAENDEAARAMSEA(b) CRAGGFPWDQPGTSNMy PDB code: 3GRS residue point: HIS467 mutation: LEU Describe why this position in your protein is important and outline the effects the mutation will have on the 3D structure and the function of your protein. (up to 50 words)1. Which peptide would be more soluble at pH 7.0, (Val)₂₀ or (Asp)₂₀ ? at pH 3.0, (Gly-Glu-Val)
- A peptide with 12 amino acids has the composition (not sequence) Asp 2Cys 2Glu 2Leu 2Ser 2Tyr Val. It also has Ser as the N-terminal residue and Cys as C-terminal. Partial acid hydrolysis gave these peptide sequences: (a) SerLeuTyr (b) TyrCys (c) LeuTyrGlu (d) GluLeuGlu (e) SerValCys (f) CysSerVal (g) GluAspTyr . What is the peptide sequence?don't copy 6. A protein-ligand binding reaction is run. At equilibrium, half the protein is ligand bound, the unboundligand concentration is 0.657 nM. Calculate the koff value for this reaction. Assume the kon value is typical ofprotein-ligand interactions.Draw out this peptide using condensed or line-bond structures: His-Thy-Phe-Cys-Glu examine your drawing of peptide for each amino acid, indicate what type(s) of interactions it can contribute to protein tertiary structure
- Please ASAP. Thank you. How does the mutation change/affect the structure of the Hb heterotetramer (ie how is quaternary protein structure affected)?A sample of an unknown peptide was dividedinto two aliquots. One aliquot was treated with trypsin; the otherwas treated with cyanogen bromide. Given the following sequences(N-terminal to C-terminal) of the resulting fragments, deduce thesequence of the original peptide.24. The sidechain of the amino acid serine is -CH2-OH. Serine is classified as this type of amino acid (side chain): a) hydrophobic and nonpolar b) hydrophilic and polar c) acidic d) basic