The anticodon sequence created from the following DNA: TACGGGGCTGAGATT Select one: O a. AUGCCCCGACUCUAA O b. Met-Pro-Arg-Leu-STOP O c. UACGGGGCUGAGAUU O d. Tyr-Gly-Ala-Glu-lle
Q: How does the nephron filter blood back into the body
A: The nephron is the kidney's primary anatomical and functional unit responsible for blood filtration…
Q: Which of the following statements are correct for retroviruses? Mark all that apply. A. Replication…
A: Small and contagious, viruses can only reproduce themselves inside the live cells of other species.…
Q: describe the ovarian cycle and how it differs between species.
A: The follicular phase, ovulation, and luteal phase are the three main phases of the ovarian cycle.…
Q: 4. Acquired or adaptive immunity can be divided in to Natural Active, Natural Passive, Artificial…
A: Immunity refers to the body's ability to resist or fight off infections, diseases, or other harmful…
Q: Speciation events can occur on a variety of timescales. Which factor is NOT likely to influence the…
A: Speciation is the process by which a single species evolves into two or more distinct species over…
Q: Design a basic heart pulse monitoring system. The design must be a low cost device. Your answer…
A: Heart pulse rate monitoring system The device such as heart rate monitor is used to detect and…
Q: please name the muscles name all three S
A: Muscles Muscles are groups of tissues in the body that have the ability to contract, producing…
Q: Explain this Dichotomous key Each step
A: Culture media are necessary for growing microbes to study them further. Culture media of selective…
Q: 3. Characteristics. List whether the organism is: a. Diploblastic or triploblastic (if applicable)…
A: Since you have posted multiple questions with multiple sub parts, we will provide the solution only…
Q: What bonds hold dna based together
A: DNA (deoxyribonucleic acid) bases are the building blocks of DNA. There are four types of DNA bases:…
Q: The most significant determinant of basal metabolic rate is: O age O sex O total muscle mass versus…
A: Basal Metabolic Rate is the amount of energy (measured in calories) that a person's body needs to…
Q: The -CH3 side chain of an amino acid would be: hydrophilic hydrophobic acidic polar basic Previous…
A: Aminoacids are the basic building blocks of life. These form long chains by joining with each other…
Q: Sodium-Potassium Pumps (N+/K+ ATPase) are fundamental to your body’s physiological function. What is…
A: The sodium-potassium pump, or Na+/K+ ATPase is a critical mechanism for maintaining the…
Q: Draw guanosine 5'-diphosphate. • You do not have to consider stereochemistry. • You do not have to…
A: GDP (guanosine-5'-diphosphate)is a type of nucleoside diphosphate. It is a ester composed of…
Q: The desert pupfish is a group of small fish species found in isolated desert springs. What type of…
A: Speciation is the process by which new species arise from existing ones. It occurs when populations…
Q: Q2.21. Which of the following statements about decomposition rates is well supported by the data…
A: Decomposition is a process carried out by microorganisms. In this process complex organic substances…
Q: What is the mRNA transcript for the DNA sequence TTA CGC?
A: mRNA is produced from DNA by the process of transcription in the presence of enzyme RNA polymerase.…
Q: 1. Describe the first, second, and third lines of defense. How do they overlap and interact with…
A: The immune system is a complex network of cells, tissues, and organs that work together to protect…
Q: In humans, long eyelashes (L) are dominant to short eyelashes (1). On the left are three boxes, each…
A: Homozygous:The presence of two identical alleles at the particular gene locus. Heterozygous:…
Q: What does the punnet square look like for a colorblind man who marries a normal-vision woman?
A: Colour blindness is defined as a genetic condition during which an individual lacks the ability to…
Q: What evolutionary changes need to occur for an animal pathogen to become a human pathogen? Name…
A: For an animal pathogen to become a human pathogen, several evolutionary changes need to occur. These…
Q: this is out of order
A: Cell transport is the movement of substances within cells (intracellular) or between cells…
Q: You have 500ml of a bacterial culture (cell density 1x10^6 cells/ml). How would you want to prepare…
A: Provided, Stock solution volume 500ml concentration 10^6 cells/ml Desired solution: volume 5ml…
Q: Glucose-6-phosphate isomerase is used to do which of the following steps of glycolysis
A: The metabolic pathway where glucose is converted into pyruvic acid is known as glycolysis. These…
Q: 133. A 55-year-old woman is brought to the physician by her husband because of a 1-year history of…
A: A neurotransmitter is a chemical substance that is released by neurons (nerve cells) in response to…
Q: Which of the following is not a way that living in a social group can provide protection for the…
A: Interactions between individuals, often those of the same species, that are typically advantageous…
Q: a. What colors of light would you see if you look through rose colored glasses? b. If you are…
A: Colors are visual perceptions that are created by the way light reflects off of objects and enters…
Q: What is different about the behavior of the external urinary sphincter from most other voluntary…
A: The external urinary sphincter is a unique voluntary muscle in that it is under both voluntary and…
Q: Discuss the acrosomal reaction. Does this reaction occur in all vertebrates?
A: The process through which male and female reproductive cells or gametes converge to create a new…
Q: Explain why stem cells supplied are needed in some tissues of the adult mammal to maintain tissue…
A: Stem cells are the most initial cells that have the ability to differentiate and give rise to all…
Q: What is the role of antidiuretic hormone in creating dilute vs. concentrated urine
A: Antidiuretic hormone (ADH) or vasopressin is a hormone that help in controlling blood pressure and…
Q: Which of the following factors can contribute to sympatric speciation? Select all that apply. 0000…
A: This is a multiple-choice question that asks about the factors that can contribute to sympatric…
Q: 5. Describe extracellular killing. Which cells are capable of extracellular killing?
A: The immune system is a complex network of cells, tissues, and organs that work together to protect…
Q: Species interactions can be categorized into five different groups. List, define them, and provide…
A: Interaction between species plays a major role in various biological process such as nutrient…
Q: 6. What is a nosocomial infection? Which areas of the body/types of patients are most susceptible?…
A: Nosocomial infections, or hospital-acquired infections, are a significant concern in healthcare…
Q: Research an invasive species and include the following: Scientific name and common name (if the…
A: Non-indigenous species, also known as exotic or invasive species, are species that have been…
Q: 4. What does the typical pattern of infection look like?
A: The term "infection" describes when microorganisms invade and multiply within the body. These…
Q: 1. List the mRNA base codons for the amino acids listed below. 2. a) aspartate: b) lysine c)…
A: mRNA base codons are sequences of three nucleotide bases (adenine, guanine, cytosine, or uracil) in…
Q: J, K, L, M, and N are five genes found on a single chromosome in rabbits. The recombination…
A: Recombination frequency is a measure of the frequency of recombination or crossing-over between two…
Q: When describing vegetative propagation, what is meant by the proximal end of a cutting? Group of…
A: Vegetative propagation is the process in which new plants are grown from the old parts of a plant.…
Q: 2. There are many theories on how/why some people develop autoimmune disease. In terms of clonal…
A: When the immune system attacks the body's own cells and tissues the autoimmune disorders develop.…
Q: A mutation in the Pitx1 gene prevents development of pelvic spines in stickleback fish. Analyses of…
A: Mutations are changes that occur in the DNA sequence of an organism's genome. They can be caused by…
Q: Describe the mechanism of Cortisol and how it works to produce an emotion.
A: Cortisol is a steroid hormone produced by the adrenal glands in response to stress. It plays a…
Q: 30*_SP23-General Biology I (for ma A 1:1 phenotypic ratio will occur when which of the following…
A: In this question, we are investigating a hereditary cross between two living beings, centering on…
Q: Starting with a 2n = 32 cell, at the end of meiosis II there will be Multiple Choice two cells; each…
A: Meiosis is a type of cell division that produces four genetically diverse haploid daughter cells…
Q: 1.A type of tough, flexible connective tissue that holds bones together is called what? 2.A group…
A: The musculoskeletal system, also known as the musculoskeletal system or locomotor system, is the…
Q: Which of the following is true about tRNA? Select one: A. All tRNAs have a CCA sequence at the…
A: tRNA stands for transfer RNA, which is a type of RNA molecule that plays a critical role in protein…
Q: 1. What are the functions of MHC I and MHC II? Which cells have MHC I? Which cells have MHC 2? Do…
A: Major Histocompatibility Complex (MHC) it's a tightly linked cluster of genes, which plays an…
Q: What is the rate of carbohydrate absorption vs fat and fiber? How does blood glucose react to…
A: The rate of carbohydrate absorption is generally faster than that of fat and fiber. When we consume…
Trending now
This is a popular solution!
Step by step
Solved in 4 steps
- 31_30*_SP23 - General Biology I (for m 24 ed out of nove flag evious page A $ Transcribe the following DNA: TACGGGGCTGAGATT Select one: O a. UACGGGGCUGAGAUU O b. Tyr-Gly-Ala-Glu-lle C. Met-Pro-Arg-Leu-STOP O d. AUGCCCCGACUCUAA MacBook AirG-Unit 5: DNA anc X https://docs.goog x y google classroom x A Classes QLSeyPC6Kmoa0k5JJd1DWGzqqRwaQQobHNOOdqFX_aDbV_6-bKw/formResponse of Distance Le... Launch Meeting - Z.. 4 2020 HORNETS 4N... StudentVUE Clear s How is a protein made in the cell? * One strand of DNA in the ribosome combines with amino acids. Two strands of DNA in the nucleus combine with amino acids. One strand of RNA in the ribosome is the template (model) for an amino acid sequence. Two strands of RNA in the nucleus are the template (model) for an amino acid sequence. Use the chart to determine the correct amino acid that this DNA would code for - ATA EGFL Y. UCAGUCAG Gutame Aspart acIII. Deletion of C IV. Both I & II 6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment Human_AA Oyster AA Corn_AA -MKLEWLLFTIGFCWAQYSSN--TOOGRTSIVHLFEWR-------WVDIALECERYLAPK 50 -QVILNCLLYVvGVVRGGTWSNPTCAPGRHTITHLFEWK- -WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSOVLFOGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. %3: .. O Human_AA Oyster AA Corn AA GFGGVOVSPPNENVAIHNPFRPWWERYOPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVOISPPNENRIVTSPNRFWWERYOPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPOGYMPGRLYDLD------ASKYGTHAELKSLTAAFHAKGVKCVA 114 ::*.. : ::.:. :.*: Human_AA Oyster AA Corn AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG------TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: * ***** Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one II. three IV. four b) What…
- Final Assessment for Exploring M X forms/d/e/1FAIpQLSe8RrfvHEr59pISGjbEneL041GxKTvyw9-Xc_EA7Um_8xqReA/viewform?hr_submission-Chg1990yzQ8SEAjwvY285... First mRNA base (5) end of codon) A Sequence C Sequence D 5. A DNA sequence of "ACG" will code for the amino acid UUG CUC CUA CUG wh GUC GJA GUG Cys 100 AUU AUC lle ACC AUA ACA AUG MACG] Val M Second mRNA base UCA UCG The GCU GCC.. GCA GIGA CAA CAG Tyr UAC UGC UAA Stop UGA Stop A UAG Stop UGG Tro AAU AAC MT AAC GAC GAG 2 Lys Asp CGA CGG AGU AGC AGA AGG Lys GGU GGC GGA GGG Arg DUAU Gly C Third mRNA base (3' end of codon) Lys (K) DELL C GU A C DEOTOCCAGUCAGUCAGUCHOSOTOS M G (F) A (LS1-1) * GU A C CUGA OPCUGACU GACUSACCO AD A G OCO Trp (W) \u« 9799%3Fo 33 42015347/quizzes/5825797/take 17. The DNA code for a gene is: TAC GGG ACA GCG. What is the codon for the mRNA? DNA coding strand bases messenger RNA non-coding strand O TAC GGG ACA GCG ATG TTT TAT CGC O AUG CCC UGU CGC O Ala-Phe-Ser-Lys O Morc than one correct answer11.5 A A Aa-AE-E-¹5- U - abe X₂ X² A-ay-A- Font Ulla Unigriffin DNA: mRNA: amino acids: traits: DNA: traits: mRNA: amino acids: · DNA: mRNA: to search #N O E Et CE- Paragraph $ 15 Ser 1. CAT AGG GAG | CAA GGG TGA CTT TTT | AAT AAT GAC GGG | A E ALT | CAA TTG TTA CGG | AAA AGA CCC | GCC ATA ACA TTT | % STP | CAC CGT CGA | GTA GTA | AGA GGG CAT | TTG TAA GGA GGG GGG TGT | 16 AaBbCcDc AaBbCcl AaBbCcL Aa BbCcDc 1 Normal 1 Body Text 1 List Para... 1 No Spac... W] Tyr 17 Val & 7 Gly E CO OM no num lk T Aa Bb Cc 1 Table Pa (p)) Styles 12 P
- BM4_DNA AND PROTEIN S X /1FAIPQLSDP_g5B-629FSHNpGnTMIEppLS4A71zBd4vcUBqNUILubXONw/formResponse 4. What is the nitrogen base pair of Adenine in transcription? O Cytosine O Uracil O guanine O thymine 5. The central dogma of Molecular Biology states that There are four nitrogen bases in DNA, two purines (adenine and guanine) and two pyrimidines (cytosine and thymine). Which process is not included in the central dogma? duplication transcription translation O translocation Leadple6. Refer to the figure answer the following questions. CLUSTAL W (1.83) multiple sequence alignment R-------WVDIALECERYLAPK 50 Human_AA Oyster AA Corn_AA -MKLFWLLFTIGFCWAQYSSN--TQQGRTSIVHLFEWR- -QVILWCLLYVGVVRGGTWSNPTCAPGRHTITHLFEWK-------WSDIAAECERFLGPM 52 MAKHLAAMCRCSLLVLVLLCLGSQLAQSQVLFQGFNWESWKKOGGWYNYLLGRVDDIAAT 60 : : : : *:*. Human AA Oyster AA Corn_AA GFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYV 110 GYCGVQISPPNENRIVTSPNRPWWERYQPVSYKLVTRSGNEADLRDMVQRCNKVNVRIYA 112 GATHVWLPPPSHSVAPQGYMPGRLYDLD---ASKYGTHAELKSLTAAFHAKGVKCVA 114 :: *.. ::: .:. : * Human_AA Oyster AA Corn_AA DAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDG-KCKTGSGDIENYNDA 169 DVVINHMTG-AGGSGTG-TGGSHWDGGSLSYPGVPFSSWDFNSGSECSTGDGNIHNYNDP 170 DVVINHRCA---DYKDGRGIYCVFEGG---TPDSRLDWGPDMICSDDTQYSN--GRG 163 :: Figure: Sequence alignment a) How many different species are used as the source of sequence in this analysis? I. two I. one III. threel IV. four b) What does the (*) mark mean in this alignment result? I.…C 2 ⒸCP Biology 2022-2023 Unit 7 Pro x app.formative.com/formatives/63403369f912f69144853e8b 3 Type here to search -A FA -C FG C FA FT G T- T- Ú G- W A- ·U FA - C C CP Biology 2022-2023 Unit 7 Pro X Amino Acid GUA (2) CAU ㅗㅗㅗ | + DELL Amino Acid GCG C G C -Nuclear Membrane > Amino Acid A A A UUU Cytoplasm @4 J
- | 四 ii D YouTube W Maps 6 viewbook-for-sim. Aid & Awards - Of.. O 2022-23_UAB_pa. W Student Z - McMa. Transfer your Gma. M MarkBook CON. (a) What type of mutation would be least harmful to an organism: silent, missense, or nonsense? Explain your answer. (b) What is the difference between gene mutations and chromosomal mutations? Paragraph В I. + v ... Lato (Recom... 19px... v 民 Add a File Record Audio Record Video MacBook ProAnswer: giycogen Time left 0:4T:- If you have got the following DNA template molecules, which one of them will require more energy to break down the hydrogen bonds between the antiparallel strands? O a. GCGCGCGCGCGCGCGCGCGCG O b. GGGGGCCCCCAATTCCCCCCC O c. AAAAAATTTTTCCCCCGGGGG O d. ТAСТАСАСTGTGGTTAАТТААА Oe. АТАТАТАТСGСGTTAAATTCTА CLEAR MY CHOICE Match the given words with the most suitable words from the given list. Unicellular fungi Hyphae Choose... Охуgen Atom ENG سطح المكتبChoose the correct option for following three mcqs 10.Which of the following statements regarding solenocysteine is TRUE: It is represented by one of the cysteine codons It is called the 22nd amino acid A tRNA synthetase directly couples solenocysteine to a tRNA It is represented by the start codon AUG All of the above statements are false. 11.The process through which one gene can produce multiple types of proteins is called: RNA splicing Alternative splicing Translation Alternative translation None of the above 12.One feature which is shared by self splicing Group-I and Group-II introns is: Both contain an adenine at their branch point Both contain a guanine at their branch point Neither requires energy for intron removal Both depend on other RNAs for intron removal Neither intron assumes any secondary structure
