Need help answering these questions:Looking at the picture attached, Notice the indel symbol at location 296 of the query. What is the corresponding amino acid in the subject? How many nucleotides were inserted/deleted here? Download ✓ GenPept GraphicsRecName: Full-Serpentine receptor class beta-15; Short=Protein srb-15 [Caenorhabditis elegans]Sequence ID: 001509.2 Length: 336 Number of Matches: 1Range 1: 8 to 335 GenPept Graphics▼ Next Match Previous MatchScoreExpect MethodIdentitiesPositivesGaps192 bits (487) 2e-57 Compositional matrix adjust. 112/330(34%) 184/330 (55%) 4/330(1%)Query 4Sbjct 8Query 64Sbjct 68Query 124Sbjct 128Query 184Sbjct 188Query 244Sbjct 247Query 302CDEVNNISYDPLYRYSQFYTLLTSIFSVFPLLYLIIFKLRVCTFNDNIKFLYIVYFTQIL 63++Y P+YR S F L SI S+ PL+Y +IFKLCETAFKLTYHPIYRGSLFIHLFVSISSIIPLIYFVIFKLPKTSFHGNLKFLFSAYFVSVF67ISVLNNCVVFAHHVVIPFLAVSKCDLLVNPVKNRIFQNIGVFGISCPMLTILGITAERLL123LFSVDFAIISTTEILIPLFSKHPCNLLIPDQYLKIGNTTVSIFMSLSTFFPISITIERFI127ALIFARCYENVKLHIGVFIGVFAMLCDMALVYFFFLDEKFDQPSISYFMVPDTSGYKMNW 183A+ AR YE +++G + +L D+ +V+F + DEKFD SIS+ PTAMKMARTYEKTRVRLGPILTGCNILLDLLIVFFIYRDEKFDDGSISFVFFPKTLAPKMFT 187243LCYSLLAINSVNLVFNYFLVKINTILKEKWRNSLSTRYQMEENIITTKFSTFISFIHVFF+ + +N +N FN +L++ + LK +SL+T+YQ EE + +TKF+ F+ F HVFFWVMFFLNLINFTFNSYLLRQSIRLKVS-TSSLATKYQREEVVHSTKFAVFVVFCHVIL 246FSLYLIFTLIIRLLGPGFLKTQADLMSVRGVYIT-IPTYNLIIGIASCVILRHL-QRQKV 301ADLM+ RG + T I YNL++G + V L HL + +KFGFYVIGIMILRYFGSIFIPDPADLMATRGAFTTMISLYNLVVG-SVAVYLNHLIKTRKS 305C++ ++ ++++IP + C+LL+FY+I +I+R GF++IAKVYAEVTLKYSGIDGAQIHQEAILNVWKT 331++ V ++ +G GAQ ++ AI N+W +Sbjct 306 EEITGTVRIQATGAVGAQNYENAIFNIWNS 335+F+ N+KFL+ YF ++S+ IT ER +KMNext Previous DescriptionsRelated InformationGene - associated gene detailsAlphaFold Structure - 3Dstructure displays

Name: Need help answering these questions:Looking at the picture attached, N
Uploaded: 2024-03-20T06:42:55.000Z
Channel: Bartleby
Description: Need help answering these questions:Looking at the picture attached, Notice the indel symbol at location 296 of the query. What is the corresponding amino acid in the subject? How many nucleotides were inserted/deleted here? Download ✓ GenPept Graphi

Bioinformatics is the field of biology that employs computational tools and analysis techniques for…

Answered: What is the corresponding amino acid in…

Science

Biology

What is the corresponding amino acid in the subject? How many nucleotides were inserted/deleted here?

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter56: Animal Behavior

Section: Chapter Questions

Problem 16TYK

See similar textbooks

Similar questions

These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
To construct an “interactome” like the one shown inFigure 9-21, scientists identify all of the protein interactions in a particular tissue or cell type. Comparison ofinteractomes from human muscle versus human braintissue reveals very different patterns. If you were the scientist involved in this study, how would you explainthese results?
A C-terminal KDEL tetrapeptide was identified by “sequence gazing” as a possiblesignal for keeping resident ER proteins in the ER. This idea is now described in yourtextbook as established fact. What types of experiments do you think were performedto confirm that KDEL serves as an ER localization signal?
What type of experiment can be performed to confirm that the C-terminal KDEL tetrapeptide is both necessary and sufficient in ER localization? (Necessary meaning that without KDEL, ER retrieval would not occur, and sufficient meaning that with KDEL, we would definitely see its effect (ER retrieval would occur))
What is janus kinases (JAKs)?
Hello! Discuss the advantages and disadvantages of targeted vs mass control using COVID-19. ( if you can also link an article which talks about this it will be much appreciated!) Thank you!
Recall the location, functions, and ultimate fate of the ER signal sequence on soluble proteins.
It is not an easy matter to assign particular func-tions to specific components of the basal lamina, sincethe overall structure is a complicated composite materialwith both mechanical and signaling properties. Nidogen,for example, cross-links two central components of thebasal lamina by binding to the laminin γ-1 chain and totype IV collagen. Given such a key role, it was surprisingthat mice with a homozygous knockout of the gene fornidogen-1 were entirely healthy, with no abnormal phe-notype. Similarly, mice homozygous for a knockout of thegene for nidogen-2 also appeared completely normal. Bycontrast, mice that were homozygous for a defined muta-tion in the gene for laminin γ-1, which eliminated just thebinding site for nidogen, died at birth with severe defectsin lung and kidney formation. The mutant portion of thelaminin γ-1 chain is thought to have no other functionthan to bind nidogen, and does not affect laminin struc-ture or its ability to assemble into the basal lamina.…
sars-coV-2 spike protien what is the isoelectric point of this peptide? VGIYLQKTSDHRPEFALAMN
how would Neuroscience of Meditation, Mindfulness, and Compassion help during Covid-19?
Has Alzheimer’s disease been associated with genes other than APP? Provide evidence from the interactive that supports this claim.
Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that possess characteristics associated with normal stem cells, specifically the ability to give rise to all cell types found in a particular cancer sample. There are many biomedical engineering based approaches to detect CSCs. 1) What is the importance and advanatge of detecting CSCs? 2) What kind of systems have been developed to detect CSCs? Describe by giving examples. Please explain in detail with your own words.