What makes SARS-CoV-2 such a deadly virus? What structures allows it to be so efficient at spreading and infecting? How does it enter the body?

Q: what is the definition of science?

A: There are lots of natural phenomena that occur around us. sometimes we are able to understand them…

Q: A 72 year old man is brought to the emergency department following a myocardial infarction. He dies…

A: Acute renal damage is a common side effect of cardiogenic shock because the kidney is particularly…

Q: What is the importance of autoclaving all glassware, media and equipment used in the lab?

A: AUTOCLAVING  Autoclaving is considered as most effective method to sterilize lab equipments. It is…

Q: Herpes simplex virus and cytomegalovirus are both in the herpes virus family, but of the two, only…

A: A drug is a chemical substance given to an individual to prevent or cure a disease. Many microbial…

Q: How does the hormone Angiotensin II affect MAP? Select only one answer.   1) it increases CO by…

A: Angiotensin II (ANG-II) is a hormone released by the renin-angiotensin system and plays an important…

Q: In your own words explain endomysium and its function

A: Tissue is a group of cells that have a common origin and functions together to form specialised…

Q: 3. Which of the following is the primary stain used in Acid fast staining? A. Acid B. Carbol fuchsin…

A: Staining is a procedure used to enhance the visualization of microscopic objects to examine them…

Q: Basic electrical rhythm or slow wave is responsible for producing motility in the smooth muscle…

A: The smooth muscles of the majority of the gastrointestinal tract are arranged into two layers of…

Q: Is Xiaotingia an earlier or later bird than Archaeopteryx in this tree?

A: Introduction  Taxonomy is the branch of science that deals with classifying animals in hierarchical…

Q: the different tissues within skeletal muscles and explain how the functions links to their structure

A: There are three types of muscle tissues namely skeletal muscle, cardiac muscle, and smooth muscle…

Q: 7. We can estimate the relative mobility of a population of molecules along the surface of a living…

A: 1. SDS-PAGE (Sodium Dodecyl Sulfate Polyacrylamide Gel Electrophoresis): SDS-PAGE is a method used…

Q: Briefly explain the importance to agriculture of the following insects: 1. Oebalus poecilus 2.…

A: Insects have many economic importances.They are useful to produce honey,silk,wax etc.Humans have…

Q: 30 year old man comes to the emergency department because of generalized weakness, loss of appetite,…

A: Chelating agent produces a type of bonding of ions and molecules to metal ions. It usually forms…

Q: To limit autoimmune reactions , Beta lymphocytes become tolerant to self antigens early in…

A: T-lymphocytes mature in the thymus, while B-lymphocytes do so in the bone marrow. After being…

Q: ExplaintheadditionalhealthriskstoapatientundergoingaCT scan as compared to an ordinary X-ray…

A: Radiation is sent through the body during an X-ray, commonly known as a radiograph. High-calcium…

Q: A small mammal dies after being soaked in the rain. Plan and design an experiment to investigate…

A: Introduction:- Medical expertise is crucial in death investigations. It is being with body…

Q: Biological oxidation refers to the process in which organisms oxidize and decompose organic matter…

A: All living organisms need energy for growth and reproduction, to maintain their structures, and…

Q: (a)In conjugates_ determines the specificity of the enzyme (b)Protein biosynthesis is a complex…

A: Enzymes are the catalyst for the biochemical reaction. It helps in increasing the rate of reaction…

Q: Explain alcohol liver diseas

A: The liver damage associated with mild alcoholic hepatitis is usually reversible if you stop…

Q: Question 7: The following images were taken to study mitosis in plant cells. a. Fill in the table…

A: The cell cycle has two stages: the interphase, which marks the start of cell division, and the…

Q: Which of the following shows the correct sequence of events that occur in T cell development? of T…

A: T cells are white blood cell sub-type. T cells are produced by stem cells in the bone marrow and are…

Q: Discuss the applications,benefitsand limitations of ultra-sonography techniques. You will need to…

A: Diagnostic ultrasound, also referred to as ultrasonography or diagnostic medical ultrasonography, is…

Q: Why do you think there are more types of trisomy disorders than monosomy disorders?

A: When you have an extra copy of a chromosome, trisomy diseases develop. When one copy of a chromosome…

Q: Intracellular receptors bind to signaling molecules that are   A. anionic.   B. cationic.   C.…

A: Introduction:- Receptors are the cellular protein molecules that binds to their specific ligand or…

Q: List the. Functions performed by pancreas inour body

A: The pancreas is a large gland present in the human body. It is located behind the stomach. Its main…

Q: Where do naïve cytotoxic T cells encounter foreign antigens and become activated cytotoxic T cells?…

A: Naive t- cells are basically T- lymphocytes that have never been exposed to antigens since their…

Q: What is anabolism?

A: Metabolism is the sum total of catabolism and anabolism. Anabolism is a biochemical process of…

Q: A decrease in blood water levels is detected in the brain. The brain sends signals to the pituitary…

A: In this question, a process is explained and it has to be correctly identified. First of all, let us…

Q: 14. Extracellular signal molecules that are hydrophilic must bind to a cell-surface receptor in…

A: The ability of a cell to receive, process, and transmit messages with its surroundings and with…

Q: In which type of plants are Nitrogen fixing bacteria present

A: Nitrogen (N2 ) is one of the important gas presents in the atmosphere. This form of nitrogen is…

Q: Discuss the disadvantages of Raman spectroscopy and how to deal with the disadvantages…

A: Raman spectroscopy: Raman spectroscopy is a technique that is used to identify the molecule's…

Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…

A: Peptide 1 is migrate most slowly during size exclusion chromatography

Q: What are co -enzymes ?give an example .

A: Enzymes are made up of proteins which help in increasing the metabolism or chemical reaction speed…

Q: Addition of which of the following components to any C3 convertase leads to the formation of C5…

A: The innate immune system is the body's first line of defence against foreign invaders. It is a…

Q: MicroRNAs (miRNAs) are short, noncoding, single-stranded RNAs approximately 19-25 nucleotides in…

A: Micro RNAs are small RNAs that are capable of binding messenger RNAs and they keep destroying them.…

Q: After sepsis 27-year-old patient has bronze color of the skin which typical for Addison disease.…

A: Hyperpigmentation is a condition in which the skin develops irregular dark patches due to the…

Q: 10. When a primary signal needs to be sent to most cells throughout a multicellular organism, the…

A: The answers to the above questions are given below with explanation.

Q: Using the genetic code table provided below, identify the open reading frame in this mRNA sequence,…

A:

Q: Bone screw insertion. An increasingly common method of surgically stabilizing a broken bone is by…

A: In order to repair whole bone fractures, orthopaedic surgeons typically use "subjective feel" to…

Q: Describe the structure of bacterial DNA, provide a drawing or picture?

A: Bacterial DNA is the genetic material found in bacteria. It consists of a single circular…

Q: Choose the option that is best described by each of the following statements 1 1. Attacks the…

A: Enzymes are the biocatalyst which increases the rate of chemical reaction,without itself being used…

Q: What are the considerations we need to consider in choosing methods in introducing recombinant DNA…

A: Introduction:- Recombinant DNA technology is the set of techniques which are employed in isolation,…

Q: Step 1: select two different species (one eukaryotic and another prokaryotic and do the taxonomy.…

A: Introduction:- Living organisms are classified into different groups on the basis of similarity and…

Q: Describe the general effects of alpha, beta, and gamma radiation on living cells

A: Radiation exposure may have a variety of consequences on the body, some of which may take years to…

Q: The cells of neuroglia are formed from two sources: ectoderm and mesenchyme. What cells have the…

A: Introduction  through the various diffrenciation of cells such as neural plates , neural groove and…

Q: diversity of receptors surface of B cells. 單選: A. Rearrangement of B cell receptor genes B. can…

A: The transmembrane protein found on the surface of B cells is the B cell receptor. This B cell…

Q: In the learning process of biochemistry, we find that many biomolecules have helical structure.…

A: Introduction Proteins are biomolecules composed of monomer units called amino acids that are…

Q: A steady increase in the excretion of sodium and chlorine ions causes the insufficiency of one…

A: Introduction:- Hormones are the chemical messengers which are released by endocrine glands, directly…

Q: III. Go to the NCBI home page. Answer the following questions using keyword "Helicobacter pylori" to…

A: Helicobacter pylori is bacterium which usually infect the stomach of humans. In stomach, these are…

Q: P₁ P₂ F₁ F2 3.3 days² 4.7 days² 6.6 days² 19.2 days² 12.1 days² a) Given the variances from these…

A: Heritability is the term used in breeding experiments in which one calculates the variation in any…

Viral Infections

Viruses are abundantly found, minute entities that have genetic material enclosed within a protein coat. The proteinaceous material enclosing the genetic material of the virus is called a capsid. The genetic material could be either DNA (deoxyribonucleic acid) or RNA (ribonucleic acid). A virus is too minute to be looked at with naked eyes and therefore visualized with the help of a microscope. They are acellular entities that require a host for processes, such as replication, transcription, translation and multiplication. Plants, animals, and bacteria act as host wherein the virus reproduce. Viruses cannot multiply outside the host's body and thus are considered nonliving outside the host body.