A mutant haploid strain of Saccharomyces cerevisiae(yeast) called cox2-1 was found that was unable togrow on media containing glycerol as the sole sourceof carbon and energy. (Glycerol is a nonfermentablesubstrate for yeast.) This strain could, however, growon the fermentable substrate glucose. Researchers discovered that cox2-1 cells lack a mitochondrial proteincalled cytochrome c oxidase.a. Explain why cox2-1 cells can grow on mediumcontaining glucose but not on glycerol medium.

Q: Plant breeders have long appreciated the phenomenoncalled hybrid vigor or heterosis, in which…

A: Heterosis:   It is an outbreeding enhancement that improves quality in hybrid offspring. Mixing of…

Q: Notably, one subunit of APC itself must remain phosphorylated at a single amino acid during sister…

A: In the phosphorylation reactions, proteins are reversibly modified. It is a regulatory reaction. The…

Q: scientists published a paper describing three unusual human families where some individuals ex-…

A: Mitochondrial DNA is unique because it is only passed from the mothers to the developing zygote.…

Q: VARIATIONS IN GENE EXPRESSION In humans, the glucose-6-phosphate dehydrogenase (G6PD) gene involved…

A: Introduction Genes are the basic unit of heredity. One gene has two alleles. Each allele is…

Q: Cytoplasmic inheritance occurs when genetic information is transmitted by means other than through…

A: Cytoplasmic Inheritance is the gene transmission occurring outside the nucleus. As we know that in a…

Q: Variations in Gene Expression In humans, the glucose-6-phosphate dehydrogenase (G6PD) gene involved…

A: In the Sex-linked inheritance , both X and Y chromosomes are sex chromosomes. The genes of sex…

Q: What are two examples of cytosolic chaperone proteins involved in mitochondrial protein import?

A: Mitochondria is the powerhouse of the cell and he is involved in the synthesis of proteins. The…

Q: Match the following proteins to their functions ✓ Cathepsins ✓ Calpains ✓ Granzyme B ✓ Apoptosis…

A: Introduction A rectilinear chain of amino acids joined by peptide bonds constitutes a protein.…

Q: if there were two amino acid signal sequences were expressed on a aingle protein. where should the…

A: *Cells have various transport systems to make sure that proteins arrive at their correct…

Q: The biogenesis of functional mitochondria is dependent upon the products of both nuclear and…

A: Mitochondria are the membrane-bound cell organelles that generate most of the chemical energy needed…

Q: In a haploid yeast strain, eight recessive mutationswere found that resulted in a requirement for…

A: A rapid change in the sequence of DNA (deoxyribonucleic acid) due to physical or chemical factors is…

Q: When fertilized sea urchin eggs were incubated in sea water containing radioactive methionine, which…

A: Proteases and Phosphatases are not much involved in variation in the cell cycle. CDKs remain…

Q: Deletions in the mitochondrial DNA can result in parasitic mitochondria which do not respire but…

A: This can be explained on the basis of use and disuse of organs. The organs that are not usually…

Q: How would a dominant-negative Arf1 protein affect (or not) the following processes.…

A: Arf1 is a small GTPase that is involved in vesicular transport. It has been shown to play a role in…

Q: The yeast cohesin subunit Scc1, which is essen-tial for sister-chromatid cohesion, can be…

A: The foundation of sister chromatid cohesion is the cycle by which chromatin-related cohesin protein…

Q: Why is it reasonable that eukaryotes have aDNA polymerase (Pol ) that operates only in…

A: Introduction: DNA is a type of nucleic acid that is present in the nucleus of the cell. It is the…

Q: Streptomycin resistance in Chlamydomonas may result from a mutation in either a chloroplast gene or…

A: A scientist, Ruthsagar in 1965 reported in green algae ( Chlamydomonas reinhardi ) some cases of…

Q: Which complex is the only complex from the respiratory pathway that has noproteins encoded by the…

A: The complex II in the respiratory chain is encoded only by nuclear genes. The proteins for other…

Q: Kearns-Sayre syndrome (KSS), Pearson syndrome,and progressive external opthalmoplegia (PEO) arerare…

A: It is given that Kearns-Sayre syndrome (KSS), Pearson syndrome, and progressive external…

Q: The three homeodomain proteins Abd-B, Abd-A, andUbx are encoded by genes within the Bithorax…

A: Homeotic genes are a set of genes that are involved in the regulation of the pattern of anatomical…

Q: motner nas a nign neteroplasmiC load in ner germ celiS (celis that Will produce ner eggs). Which the…

A: Within a cell or person, heteroplasmy refers to the existence of more than one form of organellar…

Q: Which of the following statements describes the correlation between the genotype, phosphate…

A: Given: Need to find which statement describes the correlation between the genotype, phosphate…

Q: Mitochondrial matrix proteins can never be mis-targeted to the endoplasmic reticulum during…

A: Option A is correct

Q: The chromosome 9/22 translocation associated withCML (chronic myelogenous leukemia) is called…

A: The translocation of C-ABL gene into the BCR gene makes a BCR-ABL fusion gene which codes for an…

Q: The Perrier1 mutation of Chlamydomonas results in cells unable to generate ATP by oxidative…

A: Oxidative phosphorylation is the process in which ATP is formed as a result of transfer of electrons…

Q: Yarrowia lipolytica(Yl) is a non-conventional yeast that diverged from baker’s yeast, Saccharomyces…

A: Allosteric enzymes are those enzymes whose catalytic activity is regulated in response of certain…

Q: Some living organisms are under considerable pressure tostreamline their genomes for the sake of…

A: They are endosymbionts that over time lost many of their genes or transported them to the nuclear…

Q: Suppose a new mutation arises in a mitochondrialgenome. Explain what would have to happen in…

A: Mitochondria is a cell organelle present in every animal cell and is responsible for the generation…

Q: . In a certain plant, the flower petals are normally purple.Two recessive mutations arise in…

A: Since we only answer up to 3 sub-parts, we’ll answer the first 3. Please resubmit the question and…

Q: A mitochondrial transfer technique may offer a potential solution for women with mtDNA-based…

A: Mitochondrial inheritance is a part of cytoplasmic inheritance in which the genes present outside…

Q: Three polypeptides, the sequences of which are represented below using the one-letter code for their…

A: In peptide 1, - (ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG) Total number of negatively charged…

Q: Explain the action of the mitochondrial uncoupling protein

A: An uncoupling protein (UCP) is a protein present in inner mitochondrial membrane.

Q: why is marker enzyme such as glutamate dehydrogenase associated with mitochondria organelles used in…

A: Enzymes are biological molecules that perform the function of reaction catalysis by lowering the…

Q: In Figure 3-20, what color is used to denote cytoplasmcontaining wild-type mitochondria?

A: In Neurospora, maternal inheritance of the poky mitochondrial mutations was observed, with maternal…

Q: sweet peas, the given enzymatic pathway result to pigment formation in the flowers:…

A: The example shown here is the example of epistasis where one gene is masked that is suppressed by…

Q: Mutants of cyclin B that are resistant to degradation by the cyclin B protease have been generated.…

A: Mutants of cyclin B have been generated .These mutants show resistance to degradation by cyclin B…

Q: For each of the following mutant E. coli strains,plot a 30-minute time course of concentration…

A: Hello! Since you have posted multiple questions, we are answering only one part of the question. If…

Q: A human gene called theCFTR gene (for cystic fibrosis transmembrane regulator) encodes aprotein that…

A: A disease is an abnormal condition that negatively impacts the structure and function of an…

Q: What are two examples of cytosolic chaperone proteins involved in mitochondrial protein import? Upon…

A: Proteins are biological macromolecules, made up of polymer of amino acids called polypeptides. Each…

Q: In our feeding experiment with vermilion/brown and cinnabar/brown mutant flies, we were supposed to…

A: kynurenine or hydroxykynurenine is a chemical compound that is produced when an amino acid called…

Q: The rosy (ry) gene of Drosophila encodes an enzymecalled xanthine dehydrogenase. Flies homozygous…

A: The bristle and wing phenotypes of offspring are the result of the order of ry564 and ry41 relative…

Q: Wild-type fungus, protein E (encoded by the haplosufficient gene E) normally dimerizes to catalyzes…

A: Each organism's DNA sequence is unique. Its base-pair sequence might vary from time to time. It is…

Q: Assume that diploid plant A has a cytoplasm genetically different from that of plant B. To study…

A: Pollination is the process of transporting pollen from the anther (male part of a flower) to the…

Q: Where are the Ran-GAP and Ran-GEF proteins predominately located?  They are both inside the nucleus…

A: Often certain proteins are seen inside and outside the cell environment that helps in cellular…

Mitochondrial Mutations

A mitochondrion is a cellular organelle that serves as the site for cellular respiration and energy production (ATP or Adenosine Triphosphate). It is a double-membrane-bound organelle and is only present in eukaryotic cells.