In your own words, restate the three tenets of cell theory Describe the distinctive properties of the four major classes of carbon-based macromolecules: lipids, carbohydrates, amino acids, and nucleotides. In your response, provide at least one example of each. (2 points) Describe the roles of the following in DNA Replication: primase, helicase, DNA polymerase, ligase, Okazaki fragments

The cell theory was first proposed by scientists Matthias Jakob Schleiden and Theodor Schwann in…

Answered: In your own words, restate the three…

Science

Biology

In your own words, restate the three tenets of cell theory

Biology: The Dynamic Science (MindTap Course List)

4th Edition

ISBN:9781305389892

Author:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Publisher:Peter J. Russell, Paul E. Hertz, Beverly McMillan

Chapter14: Dna Structure And Replication

Section: Chapter Questions

Problem 12TYK

See similar textbooks

Related questions

Q: POTENTIAL IMPACT OF "Land use effect on benthic micro-invertebrate communities in streams".

A: Land use is a major global concern because the disturbances caused by it result in soil erosion,…

Q: Step 1: select two different species (one eukaryotic and another prokaryotic and do the taxonomy.…

A: Introduction:- Living organisms are classified into different groups on the basis of similarity and…

Q: Which of the following vaccines is a conjugate vaccine? A. Hepatitis B B. Hepatitis A C. COVID-19 D.…

A: Introduction Immunization or vaccination is a type of simple and effective way to protect our body…

Q: Which of the following life stages is the parasitic stage of Unionidae mussels? Question 3…

A: Unionidae mussels are the largest family of freshwater mussels belonging to the order Unionida. They…

Q: Use the graph to justify why DNA alone does not determine susceptibility to disease in identical and…

A: DNA is the genetic material in most living organisms. It is the information hub of the cell that…

Q: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3:…

A: Peptide 1 is migrate most slowly during size exclusion chromatography

Q: moose the correct option NA repair is necessary because : -) DNA replication results in…

A: DNA repair is a process in which the wrong and inserted bases are removed and replaced by the…

Q: what are the nutrition facts and calories showing calculation for all IV infusions including: 1)…

A: The infusion provides potassium ions, which are essential for maintaining normal cellular function,…

Q: In your own words explain endomysium and its function

A: Tissue is a group of cells that have a common origin and functions together to form specialised…

Q: Using the genetic code table provided below, identify the open reading frame in this mRNA sequence,…

Q: 17. Which part of the human body can be removed and would not affect normal function of the body at…

A: The human body can be called a highly structured organization that is both intricate and…

Q: i) What is the most likely mode of inheritance for this pedigree? ii) State the genotypes of…

A: In order to study a Pedigree the first and foremost thing which is required is to know the pattern…

Q: what marijuana can do to a person's mind, body, and health

A: Marijuana is a psychoactive drug produced by the Cannabis plant. It is mainly used for the…

Q: Herpes simplex virus and cytomegalovirus are both in the herpes virus family, but of the two, only…

A: A drug is a chemical substance given to an individual to prevent or cure a disease. Many microbial…

Q: Primary immunodeficiency disorders

A: Immunodeficiency: It is the absence or result of elements of the immune system such as phagocytes,…

Q: Compare and contrast the receptor-binding proteins of the envelope and the receptor used by the…

A: SARS - COV- 2 stands for severe acute respiratory syndrome coronavirus virus 2. It is highly…

Q: Which of the following should be done before organ transplantation? 1. Blood group typing II. HLA…

A: An organ is removed from one body and placed in the body of the recipient during an organ transplant…

Q: (75) A 6-year-old is brought to the physician for a follow-up examination because of recurrent life…

A: The immune system's capacity to operate correctly is impacted by immunodeficiency diseases. These…

Q: Compare the digestive, respiratory and circulatory system of E coli bacteria and Cactus, then…

A: We all know that E.coli is a bacteria which is mainly a prokaryotic cell and Cactus is mainly a…

Q: Which of the following could attribute to variation within a species? Choose all that apply.…

A: Variation within a species is the diversity of characteristics that exist among different members of…

Q: Why is cell differentiation important to polar bears?

A: Polar bears are significant threats to human lives and property because they are strong predators.…

Q: 8. What is a mutation? 9. What is sickle cell anemia? 10. What is hemophilia?

A: Introduction A gene is the physical and functional unit of heredity. They pass information from one…

Q: What would be the effect of increased (or decreased) concentration of extracellular Ca2+ on the…

A: "Neurotransmitters can serve as chemical messengers for ion channels, neurotransmitter mainly causes…

Q: 10. The animals being raised in CAFOS get their than them and roaming to find food. 11. With the…

A: The livestock sector plays a significant role in the world's food system, helping to reduce poverty,…

Q: ur answer. Table 1 Genotype (i) I-P+O+Z+y+ (ii) I+P+OCZ+y+ (iii) ISP+O+Z+Y+ (iv)…

A: First understand what is lac operon 1. In lac operon there are certain genes and a promoter in…

Q: The gene for red-green color blindness is recessive and X-linked. What will be the expected…

A: Human eyes are capable of detecting three colours: red, green, and blue. These colours are…

Q: What are the variations in the spores of genus Thelypteris

A: Thelypteris is a genus of ferns that belongs to the family Thelypteridaceae, subfamily…

Q: 3. Draw the needed cells and identify the number of chromosomes Scenarios A parent somatic cell with…

A: Somatic cell is a diploid cell which contains chromosomes in pairs. Haploid cell means that…

Q: airway resistance

A: Airway Resistance: It is defined as the measurement of impedance(amount of resistance) to the…

Q: Which are correct regarding blood pressure? [Select all that apply] a. Blood pressure decreases as…

A: Blood pressure is the measure of force exerted by the blood on the walls of the arteries. It can be…

Q: Figure 3 shows translation elongation in progress. What is the structure labelled A, B, C and D in…

A: Translation is the process of copying the information on an mRNA into a sequence of amino acids to…

Q: Discuss the role of each of these factors in the causation of the COVID 19 pandemic: zoonotic…

A: Coronavirus is a single-stranded RNA virus with an envelope. As suggested by the name, it is a…

Q: mutations that happened to the cactus (eukarotic cells)

A: Mutation is a loss or sudden change in DNA sequence it happens where one or more nucleotide is…

Q: 4. If a mutation occurred within the chromosome ABcDefgHI that changed the genetic information to…

A: A "mutation in a gene that codes for a protein involved in a crucial biological process, such as DNA…

Q: Select a type of microscope and specimen preparation method to observe the following biological…

A: Cancer is one of those diseases which if not detected on time, will cost a life. So, accuracy,…

Q: Figure 1 shows a schematic of an action potential. How do voltage-gated sodium channels contribute…

A: A neuron can take input from the other neurons and, if the input is powerful enough, convey the…

Q: Sickle cell anemia is an example of a genetic disease caused by a point mutation. To answer this…

A: Introduction - Sickle Cell AnemiaIn sickle cell anemia, the red blood cells become rigid and sticky…

Q: 8. Which animals are the most closely related based on the chart below? Common name Bobcat Jaguar…

A: Animal kingdom is divided is one of the most advanced Kingdom. Organisms present are range from…

Q: Describe how histones including H2A, H2B, H3 and H4 play a critical role in DNA packaging.

A: DNA is a vital component of life and has multiple important functions that underpin the biology and…

Q: Very briefly discuss and characterise insulin including its main actions.

A: Insulin: Insulin is a type of hormone that is primarily responsible to allow glucose in the blood to…

Q: Which of the following materials can cause a patient to develop hypersensitivity when used in either…

A: The femoral head and acetabular liner components of total hip replacement can be broken down into…

Q: differentiate the oogenesis and spermatogenesis of chicken and fruitfly.

A: Oogenesis is the process of egg cell production in female organisms, while spermatogenesis is the…

Q: Explain how eukaryotic cells originated from prokaryotic cells/ ‘invasion happened to their simple…

A: According to the endosymbiotic theory, some eukaryotic cell organelles, such mitochondria and…

Q: Required: Write four problems/ pains for which a solution is needed. Problem could be general or…

A: Biology is a vast and complex field that is constantly uncovering new insights about the natural…

Q: FILL IN THE BLANKS 1. Examples of a fat soluble vitamin are …… , …….. And examples of water…

A: Biomolecules are the macro and micromolecules produced and secreted by biological cells. proteins,…

Q: Causes of global warming explain briefly

A: The gradual increase in earth's temperature is referred to as global warming, which is a component…

Q: Describe the inside of hyphae

A: Hyphae are produced by fungi. These are long and have branching and can be seen in number of…

Q: For the E.coli. bacteria (prokaryotic species) and humans (eukaryotic species), show photos of their…

A: ANSWER: DNA is located in the cytoplasm of both nucleated and nucleus-less eukaryotic cells, as it…

Q: How will you dilute 100 μl of 25 mg/ml BSA into a final concentration of 2 mg/ml BSA?

A: BSA stands for bovine serum albumin. It has several applications in laboratories. In a microbial…

Q: What is yeast? Why is it a widely used microbe in food industrial microbiology? What characteristics…

A: "Since you have asked multiple questions, we will solve the some question for you. If you want any…

Concept explainers

Pre-Darwinian Concepts

Question

In your own words, restate the three tenets of cell theory

Describe the distinctive properties of the four major classes of carbon-based macromolecules: lipids, carbohydrates, amino acids, and nucleotides. In your response, provide at least one example of each. (2 points)

Describe the roles of the following in DNA Replication: primase, helicase, DNA polymerase, ligase, Okazaki fragments

Definition Definition A complex molecule that makes up a fundamental unit of a DNA or RNA molecule. Nucleotides are composed of a sugar, a nitrogenous base, and a phosphoric acid.

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

The short lecture you watched in our activity about DNA replication discussed how replication is initiated at the origins of replication in eukaryotes. How does this happen? Answer this by stating the following: 1. What stage of the cell cycle does initiation begin? 2. What enzymes arrive first to initiate this process?
Biologists have long been interested in the effects of radiation on cells. In one experiment, researchers examined the effect of radium on mitosis of chick embryo cells growing in culture. A population of experimental cells was examined under the microscope for the number of cells in telophase (as a measure of mitosis occurring) before, during, and after exposure to radium. The results are shown in the Figure. What is the effect of radium exposure on mitosis? Source: R. G. Canti and M. Donaldson. 1926. The effect of radium on mitosis in vitro. Proceedings of the Royal Society of London, Series B, Containing Papers of a Biological Character 100:413419.
Define the following terms: a. chromosome b. chromatin
Discuss the levels of chromosomal organization with reference to the following terms: a. nucleotide b. DNA double helix c. histones d. nucleosomes e. chromatin
In the context of cell biology, what do we mean by form follows function? What are a least two examples of this concept?
Cell Structure Reflects Function What advantages are there in having the interior of the cell divided into a number of compartments such as the nucleus, the ER, lysosomes, and so forth?
In all cells, microtubules nucleate from the centrosome and then become stabilized or collapse. What feature of microtubules contributes to this phenomenon?
In the tracking chromosomal DNA movement through mitosis experiment, how many chromosomes did each of your daughter cells contain? Why is it important for each daughter cell to contain information identical to the parent cell? How often do human skin cells divide? Why might that be? Compare this rate to how frequently human neurons divide. What do you notice?
Compare and contrast the structure of DNA and RNA. During Prophase of Mitosis, chromosomes begin to condense and are fully condensed by the time the cell is in Metaphase of Mitosis. Explain how the chromatin organizes itself from the beginning of prophase to metaphase of mitosis.
The Cell Cycle: During what stage of the cell cycle is the nuclear material doubled? Are the stages of mitosis occurring simultaneously on a meristem? In what material is the coded information of the cell stored?
Address the general properties of the chromatin within the following types of DNA: DNA undergoing active transcription DNA within a mitotic chromosome DNA immediately after passage of the replication fork centromeric DNA
Mitosis and cytokinesis are often referred to collectively as “cellular division.” Why are they more accurately called cellular replication?