Learning Task 3: TRACE THE CODEdentify the amino acids coded for by the MRNA codon using the Genetic CodeTable below.Order of basesin mRNA(codon)AUCOrder or basesOrder of bases Amino acid Codedin DNAin tRNAinto ProteinsTAGCATGCСАUACMethionineValineProcedures:Copy and fill in the tableRefer to the Genetic Code table to identify the amino acid.To determine the order of bases in the first column (DNA), second column1.2.3.(codon) and third column (anticodon), consider the complementary base pairs inDNA adenine pairs with thymine and guanine pairs with cytosine.4Example, AUG using the Genetic Code Table. Look for the first letter of the MRNAcodon on the left side of the genetic code table (A). The second letter of the MRNAon the second letter column (U) and the third letter on the right-side column (G).AUG codes for the amino acid methionine.To identify the amino acid. Look at the bases in the MRNA codon.5.Do the same with the other codons in the chart.Second lettorUUUUUCUCUUCCUCAUCGUAUUACUAA STOPUAG STOPUGUUGCUGA STOPUGG| TrpPheTyrCysSerUUALeuUUGCUUCUCCUACUGCCUCCCCCACCGCAUCACCAACAGCGUCGCCGACGGHisLeuProArgGinACUACCACAACGAGUAGCAGAAGGAUUAAUlleAonSerAUCAUAAACThrAAALysArgAUGMetAAGGUUGUCGUAGUGGCUGCCGCAGCGGAUGACGAAGAGGGUGGCGGAGGGAspValAlaGlyGluFirst letterThird letter

Codon Codon is a set of three DNA bases which code for amino acid.

Answered: Learning Task 3: TRACE THE CODE dentify…

Biology 2e

2nd Edition

ISBN:9781947172517

Author:Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:Matthew Douglas, Jung Choi, Mary Ann Clark

Chapter15: Genes And Proteins

Section: Chapter Questions

Problem 14RQ: What processing step enhances the stability of pre-tRNAs and pre-rRNAs? methylation nucleotide...

See similar textbooks

Similar questions

try w1 II. In each of the following DNA sequences, write on your answer sheet the corresponding mRNAtranscript and use the genetic code to determine the resulting amino acid sequence. Note that the givenstrands are in the 3’ to 5’ direction. Start the amino acid sequence with the start codon and end withstop codon.1. TTTTACCATCCCACAATTTA mRNA: _________________________ Amino acids: _____________________ 2. ACTACTTTCAGAGCTATATTCAG mRNA: _________________________ Amino acids: _____________________
State if the DNA is written 5' to 3' or 3' to 5' Transcribe the sequence. Include the 5' and 3' Translate the sequence (codon chart included) +1 TAGTCCAAAGGTTTACGTAAATGGGATGTCGAAATTGACTAGATCA
mRNA: 5’ – UGAUCAUGAUCUCGUAAGAUAUC – 3’ -Draw a box around the sequence where protein synthesis will begin. What is this sequence called? Does an amino acid get inserted at this site? If so, which one? -Draw in an arrow to show the direction that a ribosome will move along the mRNA strand. -From the starting point, mark off the codons, and identify the correct amino acid that will be inserted at that codon. -Draw a second box around the sequence where protein synthesis will stop. What is this sequence called? -Label the N-terminus and C-terminus of the polypeptide (amino acid) chain.
INSTRUCTION: = IF BOTH STATEMENT ARE TRUE = IF FIRST STATEMENT IS TRUE WHILE SECOND STATEMENT IS FALSE = IF FIRST STATEMENT IS FALSE WHILE SECOND STATEMENT IS TRUE = IF BOTH STATEMENTS ARE FALSE STAMENT 1: Amino acyl tRNA synthase is the enzyme responsible for joining amino acid together STAMENT 2: Nucleus is the part of the cell where translation takes place ANSWER: STAMENT 1: DNA sequences where RNA polymerase binds initially is called promoter sequences STAMENT 2: UV light causes adenine to dimerize ANSWER: STAMENT 1: Guanosine is the name of the compound formed when guanine is bonded to ribose STAMENT 2: DNA pairing is the term that refers to the process when two complementary and single stranded DNA combine ANSWER:
Transcribe and translate the DNA strand Remember to use the start and stop sequences. ACGGTACCGTTAGCCGACATCGGGGACACTGACTCG
After viewing https://www.youtube.com/watch?v=qIwrhUrvX-k , relate the structure of the three RNA to their function in building of Polypeptide and point out the characteristics of a genetic code and their function in translation. 1. Messenger RNA 2. Transfer RNA 3. Ribosomal RNA
BIOLOGY ACTIVITY -Gene Mutations and Proteins Objective: To demonstrate how gene mutations affect the production of proteins? Procedure: Use the following base sequence of one strand of an imaginary DNA molecule: AATTGAACACATGCGCCC. 2. Write the base sequence for an mRNA strand that would be transcribed from the given DNA sequence. Place your results in the table below. Use your codon table provided below to determine the sequence of amino acids in the resulting protein fragment. Place your results in the table below. If the fifth base in the original DNA strand were changed from G to C, how would this affect the resulting protein fragment? Write the new protein fragment in the table below. If G were added to the original DNA strand after the third base, what would the resulting mRNA look like? How would this addition affect the protein? Show your results in the table below. Data: mRNA from Step 2 Protein Sequence from Step 3 Protein Sequence from Step…
Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
Need help:. Researchers add poly-(CGU) to an in vitro TL system. What poly-amino acids are produced? How would the researchers determine which codon encoded each of these amino acids? 5’CGUCGUCGUCGUCGUCGUCGUCGU...3’
Let’s practice making a strand of mRNA. Finish what we started: DNA: T-A-C-T-T-A-C-A-C-G-T-C-A-A-C-G-T-G-C-C-T-T-A-G-C-C-A-T-TmRNA: A-U-GGo ahead and write out the complementary strand of mRNA above
What are the functional consequences of this deletion for lilP mRNA transcription and translation? Motivate your answer (100 words max.)
GGGAGTGTATACGGGATGAAGGCGATT MRNA What’s the Protein And what’s the phenotype

SEE MORE QUESTIONS

Recommended textbooks for you

Biology 2e

Biology

ISBN:

9781947172517

Author:

Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:

OpenStax

Biology 2e

Biology

ISBN:

9781947172517

Author:

Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:

OpenStax

SEE MORE TEXTBOOKS

Learning Task 3: TRACE THE CODE dentify the amino acids coded for by the MRNA codon using the Genetic Code Table below. Order of bases in MRNA (codon) AUC Order or bases in DNA Order of bases Amino acid Coded in tRNA into Proteins TAG CAT GC CCA UAC Methionine Valine