State if the DNA is written 5' to 3' or 3' to 5' Transcribe the sequence. Include the 5' and 3' Translate the sequence (codon chart included) +1 TAGTCCAAAGGTTTACGTAAATGGGATGTCGAAATTGACTAGATCA
Q: A mutation occurs within a gene sequence but no change is detected in the amino acid sequence. What…
A: Mutation is any change in the nucleotide sequence that occur in the DNA which can alter the amino…
Q: Label the part of the respiratory system.
A: Respiratory system consists of structures which carry oxygen from outside of body to the blood &…
Q: There is a photo of moss growing on the pavement of my driveway. How is moss able to grow like that,…
A: Introduction Mosses are a group of small, non-vascular plants that belong to the division Bryophyta.…
Q: The Central Dogma explains how ______ becomes _______. a gene; RNA DNA; replicated DNA…
A: Q. Ans:- Explanation:- Central dogma is a process where a gene that is made up of DNA converts into…
Q: Acid-Fast stain A) E. Coli -Morphology shape -Arragement -Acid-fast or non-Acid-fast B) S.…
A: Acid-fast Staining : When the smear is stained with the primary stain carbol fuchsin, it passes…
Q: All cognizant mental activities occur within Olong-term O episodic O working O sensory memory.
A: Cognizant mental activities are memory, learning, and recalling information. Learning is the…
Q: C. Differentiate mitosis and meiosis using the following table Criteria DNA Replication Number of…
A: Introduction :- Mitosis is a type of cell division that occurs in somatic cells and is responsible…
Q: How do freshwater fish regulate osmotic stress in their environment? O take in electrolytes through…
A: Osmotic stress is a physiological condition that occurs when there is an imbalance of water and…
Q: How many rabbits will be born between census 2 and 4? How many will die in that time period?
A: We can count the number of rabbits died and born by counting in between the two census. By studying…
Q: CHARACTERS 1 2 3 4 5 SPECIES…
A: The cladistic approach is a method of analyzing the evolutionary relationships among a group of…
Q: Q7. A solution of DNA (in TE buffer) gave a A260 = 0.245. The absorbance of the solution at 320 nm…
A: This answer will explain how to calculate the concentration of DNA in a given sample. We will look…
Q: The O2-myoglobin saturation curve has a hyperbolic shape so that it only releases 02 at very high…
A: Introduction Hemoglobin is a protein found in red blood cells that is responsible for carrying…
Q: 3. What is the final electron acceptor for an obligate aerobe? An obligate anaerobe? What would…
A: Organisms require energy to carry out their metabolic activities, and this energy is typically…
Q: Enzymes greatly speed up the rates of chemical reactions in the cell. What is one reason you think…
A: Introduction :- Enzymes are biological molecules that catalyze or speed up chemical reactions in…
Q: 50. In the small intestines, cells are responsible for transporting glucose into the cell from the…
A: Introduction Cell transport refers to the movement of substances, such as ions, molecules, and…
Q: NAME OF ORGANISM 1. Bat 2. Angiosperm 3. Gymnosperm 4. Club Fungi 5. Mollusk 6. 7. 8. 9. Crustaceans…
A: Introduction :- The kingdom is the second highest level of classification in the taxonomic…
Q: Single celled organisms that grow in irregular masses and include molds mildews and yeasts? How…
A: There are several types of fungi that include molds and yeasts. They are eukaryotic organisms and…
Q: 97. This family is (picture above) affected with blindness. Individual (IV.1) is clinically…
A: Introduction Pedigree analysis is the study of a family's history and the inheritance patterns of…
Q: vl Q3. Péclet number – We've seen the Péclet number Pé = as a useful metric to determine if stirring…
A: A peclet number is basically a dimensionless number and is mainly used in fluid mechanics. This is…
Q: Which statement about babbling is true? Babbling is a form of receptive language used by infants.…
A: Answer : the statement which is true about babbling is : a. Babbling is a form of receptive…
Q: In rho dependent transcription termination the rho factor binds to? You have a 18 ml sample of…
A: Introduction :- A zygote is the initial cell formed when two gamete cells (sperm and egg) fuse…
Q: 10. Important Polysaccharides: Name & Chemical Formula Drawing of 3 Subunits Organisms Function
A: The word "polysaccharides" refers to sugars where many monosaccharides form a covalent bond known as…
Q: Why are lethal dominant genes much more rare than lethal recessive genes?
A: Lethal genes when inherited by the organism causes the organism to perish. The lethality can be…
Q: Would you predict that TLR-XX is able to recognize other types of Gram-negative bacteria, in…
A: TLRs are pattern recognition receptors (PRRs) that play an important role in the recognition of…
Q: the primary function of mitchondria is a. formation of proteins b. making ATP c. burning ATP to…
A: Introduction Mitochondria are membrane-bound organelles found in most eukaryotic cells, including…
Q: You treat a cell with a fluorescently-labelled antibody that recognizes microtubules, and you…
A: Microorganisms are valuable tools for studying evolution and genetics, as they can be easily…
Q: Labrador retrievers have 3 varieties of fur colour: yellow, chocolate or black. Two genes are…
A: This example is of dihybrid cross where two traits are considered at a time. This is also an example…
Q: Is operating outside ethical principles sometimes necessary in providing patient care?
A: Introduction Health is a state of complete physical, mental, and social well-being and not merely…
Q: In the traditional alkaline lysis method, what is the purpose of SDS in sokution 2?
A: A bacterial cell has additional circular DNA (called plasmid) in addition to the chromosomal DNA.…
Q: In early spring 2009, the CDC reported several dozen cases of novel H1N1 influenza ("swine flu") in…
A: Influenza: Influenza, commonly known as the flu, is a viral infection that affects the respiratory…
Q: Discuss the experiments Griffith, Avery and Hershey/Chase did in the early 1920-50s that helped…
A: Introduction: Humans and nearly all other species carry their genetic information in DNA, also known…
Q: Which of the follwing enzymes adds incoming deoxyribonucleotid triphosphates to the 3' OH of the…
A: DNA replication is the process in which the genetic material of the cell is duplicated. It requires…
Q: SAY IT WITH DNA: PROTEIN SYNTHESIS WORKSHEET: Practice Pays Student Handout Having studied the…
A: The DNA message is read in codons that contain three nucleotides. The DNA is transcribed to create…
Q: Which is/are the most phylogenetically close to humans based on the tree above? I) lizard II)…
A: A phylogenetic tree is a diagrammatic illustration which determines how species are closely related…
Q: Why is the ½ Vmax of a reaction commonly used to determine the efficiency the reaction, instead of…
A: The answer to the problem is the first option It is impossible to know if the reaction has reached…
Q: Give a brief description if the Tulare lake region What happened to the Tulare and Bueno Vista lakes
A: Introduction An ecosystem refers to a biological community of living organisms interacting with…
Q: In a parental cross of a ADHL disease trait, where the father is affected and the mother is…
A: In the given case, let the dominant allele associated with ADHL disease be “A” and the allele…
Q: Draw and label detailed apparatus of the steam distillation apparatus used for the Isolation of…
A: Eugenol is the oil found in cloves. It's boiling point is 248 degree Celsius. It can be isolated at…
Q: 4) Which statements about mycotoxins is not true? a. They are toxic molecules made by mold b. [Fungi…
A: The statement that "High heat cooking destroys mycotoxins" is not entirely true. While some…
Q: What triggers the release of acetylcholine from a synaptic terminal?
A: Note:- Sorry, please note that as per our company's honor code, we are allowed to author only the…
Q: What is the major differences between bacteria that use anaerobic vs aerobic respiration and the…
A: Introduction :- Active transport is a process by which cells move molecules or ions across a…
Q: What is the dilution factor in the task given if the total viable cells is 140 [28×5(squares)] and…
A: The dilution factor is a measure of how much a solution has been diluted or concentrated. It is…
Q: 8. Rotenone is a chemical that naturally occurs in plants. It is a broad-spectrum poison, meaning it…
A: Rotenone is a chemical that naturally occurs in plants and has been used for many years as an…
Q: Create a flowchart to show the similarities and differences between the 3 major categories of…
A: Carbohydrates These are the most common type of organic compounds that are used to store energy.…
Q: Global agricultural land show how much percent of signs of degradation due to current agricultural…
A: Introduction :- Agricultural land is defined as land that is used for farming activities such as…
Q: Dapagliflozin is a inhibitor of the sodium glucose cotransporter so does Dapagliflozin cause glucose…
A: Dapagliflozin is called as the inhibitor of the sodium glucose cotransporter. This is responsible…
Q: A certain type of mutation converts the base cytosine into uracil. If this mutation is not repaired…
A: Mutation is defined as a change in an organism's genetic material. Nucleotide bases are the…
Q: 45.
A: Structure of Cholesterol: Cholesterol has a hydrophilic hydroxyl (-OH) group at one end and a…
Q: Consider a hypothetical beetle population, in which beetle colour varies along a spectrum from light…
A: Selection: Natural selection is the process by which individuals with advantageous traits are more…
Q: 2. Compare and contrast the morphology of the spleen and a lymph node. (i) Describe 2 ways that they…
A: The spleen is an organ located in the abdomen that filters blood and is involved in immune…
State if the DNA is written 5' to 3' or 3' to 5'
Transcribe the sequence. Include the 5' and 3'
Translate the sequence (codon chart included)
+1
TAGTCCAAAGGTTTACGTAAATGGGATGTCGAAATTGACTAGATCA
Step by step
Solved in 2 steps
- Translate to amino acids the strand using the Genetic Code chart. Remember to use the start and stop sequences. UGCGAUGGCAAUCGGUGUACCCCUGACUGAGCTranscribe and translate the DNA strand Remember to use the start and stop sequences. ACGGTACCGTTAGCCGACATCGGGGACACTGACTCGB. Using the DNA sequence above, write a new DNA sequence from 3’ to 5’ that incorporates a transition leading to a silent mutation in the second amino acid. Bold or underline the nucleotide that has been changed
- Using the genetic code, interpret the following set of nucleotides. AUGGGUCCAUGGCGUAGGCCAAAUGAUGAGGAAUGAD. Using the DNA sequence above, write a new DNA sequence from 3’ to 5’ that incorporates a transversion leading to a missense mutation in the third amino acid. Bold or underline the nucleotide that has been changed and indicate the new amino acidProtein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
- Illustrate the process of transcription by providing the correct bases for mRNA strand given the DNA template strand. (Remember that mRNA has uracil instead of thymine.) Template Strand: CGATACAAAState the DNA sequence that encodes the anticodon that recognizes the codon AAG, with 5’ and 3’ ends labeled.Write down the corresponding amino acids sequence for each mRNA sequence. Use the codon chart.
- Illustrate the process of translation by providing the correct bases for tRNA strand given the mRNA template strand. (Remember that mRNA has uracil instead of thymine.) Template Strand: GCUAUGUUUIdentify which regions of DNA encode the protein sequence. Consider that there may be introns (which often start with sequence GU and end with the sequence AG).Transcribe the following DNA sequence into RNA, and then into amino acids 5’-GTATACTTGTGGGCCAGGGCATTAGCCACACCAGCCACCACTTTCGGATCGGCAGCC-3’ 3’-CATATGAACACCCGGTCCCGTAATCGGTGTGGTCGGTGGTGAAAGCCTAGCCGTCGG-5’