- Take note Of the imporfant functions of proteins Give an example of cach. 2. Describe in no more than ten sentences the four levels of protein structure. and cite the noncovalent forcels) in each (rvel.
Q: Carbon dioxide loss, or decarboxylation, occurs in the Krebs Cycle with the transition of citrate to…
A: When there is energy demands in the cells, the acetyl CoA molecules produced through the oxidative…
Q: The percentage of Inorganic in components of plasma is 2% O 2.7% O 7% O 1% Glutamate dehydroganase…
A: Blood plasma is a colloid solution of organic and inorganic substances.
Q: Identify the 4 steps of gluconeogenesis that are different from glycolysis. Write the reactants,…
A: Gluconeogenesis (GNG) is a metabolic pathway that results in the generation of glucose from certain…
Q: Which description is true regarding beeswax
A: cera alba which is chemical name of beewax is a natural wax which is produced by honey bees. The…
Q: 2- one liter of buffer solution contains 0.1 mole of benzoic acid and 0.2 mole of sodium benzoate…
A: Given Values: pKa of the benzoic acid = 4.19 The concentration of the benzoic acid in buffer = 0.1…
Q: Which amino acid degradation will not support gluconeogenesis? Ala Cys O Trp Leu Thr
A: The correct option will be A) Alanine Gluconeogenesis is the synthesis of glucose from non…
Q: Enzyme X has a Km of 2 µM and a kcat of 104 s1. In the presence of an inhibitor, Km increases to 4…
A: Enzymes are protein molecules that speed up the reactions by decreasing the activation energy.…
Q: Answer briefly. 1.3 Why are alcoholics prone to Wernicke-Korsakoff syndrome?
A: Wernicke encephalopathy causes brain damage in lower parts of the brain called the thalamus and…
Q: 5. You are provided with a 2.5mg/ml stock solution. In the experiment you are to use a 0.05mg/ml…
A: Concentration of a constituent in solution is the abundance of a constituent divided by the total…
Q: 9. What is the purpose of the following? a) spliceosomes b) RNA polymerase c) Protein release…
A: The central dogma of molecular biology involves the processes of transcription and translation that…
Q: ow many grams of a 1:3 mixture of glucose/glycerine would be required to make 2000mL of water…
A: Glucose is an essential component of the body and is known as blood sugar. Glycerin is used as a…
Q: How many moles of ATP can be obtained from palmitoleic acid? Show your solution.
A: Palmitoleic acid, also known as hexadec-9-enoic acid, is an omega-7 monounsaturated fatty acid with…
Q: Illustrate the relationship between the following: Vitamin E, Vitamin C, Glutathione, alpha-lipoic…
A: Oxidative stress is a condition in which the concentration of reactive oxygen species (ROS),…
Q: Q6. Give the main two compounds responsible for the formation of the gels
A: Since you have posted multiple questions, we will answer the first question for you. If you want any…
Q: What role does associative learning play in drug relapse? Be sure to include memory engrams and…
A: Drugs with habit resistance can trigger dopamine transmission in the shell when taken repeatedly.…
Q: 6)Select the CORRECT answer regarding creatine: A. It is synthesized in the muscle. B. Creatine…
A: Note : Hi ! Thank you for the question. We are authorized to answer one question at a time. Since…
Q: What is the dominant biochemical activity or molecular interaction that Sickle Cell Anemia…
A: Hemoglobin is an oligomeric conjugated protein with four peptide chains joined by a…
Q: Dilution Experiment Test tube Starch concentration (/mL) Dilution factor Observation 1 500…
A: Iodine test is a chemical test that distinguishes mono- or diaccharides from polysaccharides.
Q: Complété thế table Biosynthesis Sources Functions Deficiency oxicity
A: Introduction: Vitamins are important organic nutrients required in minimal amounts for normal…
Q: 9. A man in an unconscious state suspected to result from fasting or a diabetic coma was taken to…
A: Breath smell indicates a lot more than when you last brushed your teeth. For example, breath can…
Q: They say niacin is not a true vitamin, why?
A: Niacin : It is a form of vitamin B3 made in the body from tryptophan.
Q: Use the Michaelis-Menten equation to complete the enzyme kinetic data set, when Km is known to have…
A: The Michaelis–Menten equation is used for characterizing the enzymatic rate at various substrate…
Q: Tabulate the total number of ATP equivalents that would be produced by the metabolism of the…
A: The given phospholipid has glycerol, a sugar (glucose), a phosphate group, and two fatty acids…
Q: What acid is the most widely produced acid in the United States? What is the acid found in your…
A: In living things, acid and bases are very important because the proper pH of blood…
Q: Lantus differs from "normal" insulin in that: Select one: O a. The usual insulin molecule has been…
A: Insulin glargine [GLAR geen], sold under the brand name Lantus is a long-acting insulin. It is…
Q: Explain what fishzilla are?
A: An organism that kills another organism for food is referred to as a predator. The animal that gets…
Q: fill in the blanks Complete metabolism of the fatty acid stearate will produce ( )…
A: metabolism of fatty acids consists of various metabolic processes involving or closely related to…
Q: Select the correct answer. The chemical formula for carbonic acid, a compound used in carbonated…
A: Carbonic acid (H2CO3) is a compound of the elements hydrogen, carbon, and oxygen and is formed when…
Q: Identify the name of the amino acid and its group (aliphatic, aromatic, acidic, basic, hydroxylic,…
A: Amino acids can be essential or non-essential. Essential amino acids-need to be taken through diet;…
Q: Glycogen synthase kinase 3 beta (GSK-3ß) is a serine-threonine kinase known for its ability to…
A: The given graph is a double reciprocal plot or Lineweaver-burk Plot. Solution of question a) Line B…
Q: What are the different solid phases that antibody or antigen can bind to,in ELISA? 8. What are the…
A: A solid phase enzyme-linked immunoabsorbent assay can be defined as quantitative immunological…
Q: 2 A biomolecule has a K_d of 1.6mM. A mutated-version of the same biomoleucel was bound by ligan by…
A: Given to us are ligand concentration [L] = 1mM 35% of mutated biomolecule is in bound form,…
Q: If a phage is undergoing lytic growth, which protein is bound to the operator region? O Both Lambda…
A: Phages are the vruses that infect Bacteria. They have been widely studied for the aspects like gene…
Q: An acidic amino acid has a side chain that contains O a methyl group O an alcohol group O a carboxyl…
A: Question An acidic aminoacid has a side chain that contains Answer a carboxyl group.
Q: 1. What is the role of salt and dishwashing liquid in the extraction/isolation of DNA from yeast and…
A: "DNA extraction or DNA isolation" is a procedure or a method wherein DNA is purified by physical…
Q: fill in the blanks ATP synthesis occurs at the ( ) subunit of ATP syntahase via…
A: The mechanism of ATP synthesis occurs in mitochondria to produce energy. It involves transferring of…
Q: 8 12 15 4 16 11 9 18 2 13 14 6 3 17 10 5
A: Helical wheel is a plot of all the amino acids in the protein that will help understand and…
Q: 13. AN EMULSIFYING AGENT THAT MAKES LIPIDS TO UNDERGO HYDROLYSIS? A. PEPSIN B. LIPASE C. BILE D.…
A: The digestion of lipids initiates in the mouth to encounter with saliva then it reaches in the…
Q: You obtained the following raw data when setting up a Bradford standard curve: BSA (mg/ml)…
A: The Bradford protein assay is a colorimetric assay using the Bradford reagent (acidified Coomassie…
Q: Assuming the molar extinction coefficient for para-nitrophenyl phosphate (PNP) is 55,290 mol "dm…
A: Given Values: ε=55290 c = ?A = 0.77 l = 1.5 cm
Q: The molecule shown is an effective inhibitor of the enzyme hydrolase, explain how this likley…
A: Enzyme hydrolase are group of enzymes which breaks the covalent bond in a molecule using water…
Q: Is the primary function of the citric acid eycle in ATP production? What other vital role s served…
A: Introduction: The citric acid cycle which is the tricarboxylic acid cycle is amphibolic (both…
Q: 3. Tourists miscalculated food supplics and have been starving for 2 days before reaching a…
A: Hi. Thank you for the question. As per the honor code, We'll answer the three sub-parts at a time.…
Q: What is an introduction to ANTIBODY STRUCTURE AND FUNCTION ?
A: Antibody (Ab), also known as Immunoglobulin (Ig), is a large Y-shaped protein produced by the immune…
Q: Dilution Experiment Test tube Starch concentration (/mL) Dilution factor Observation 1 500…
A: Iodine test is a chemical test that distinguishes mono- or disaccharides from polysaccharides such…
Q: The enzyme responsible for alpha 1,4-glycosidic linkage during glycogen synthesis is ( )…
A: Glucose is stored as glycogen in tissue. Glycogen is branched polysaccharide in which glucose…
Q: Show how amount of ATP (in moles) of palmitoleic acid is calculated
A: Introduction: The fatty acid present in the diet or produced through the degradation of…
Q: 4. During a lunch at a McDonald's outlet, an office employce received about 350 g of carbohydrates…
A: Note : Hi ! Thank you for the question. We are authorized to answer three subparts at a time. Since…
Q: Common structural feature of Chitin and Amylopectin and Differences of chitin and amylopectin
A: The polysaccharides molecules are monosaccharides that are connected by glycosidic linkages.
Q: The conversion of fumarate to oxaloacetate in the citric acid cycle yields one NADH. If the fumarate…
A: TCA cycle is both catabolic and anabolic therefore, it is called amphibolic. All other cycles…
Step by step
Solved in 2 steps
- The first and major effect in denaturation of proteins is that: a. peptide bonds break. b. helices unwind. c. sheet structures unfold. d. tertiary structure is changed. e. quaternary structures disassemble.Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – CtermDescribe in no more than 10 sentences the four levels of protein in structure and cite the noncovalent forces in each level
- Protein structure is determined solely by a protein’s amino acid sequence. Should a genetically engineered protein in which the original order of all amino acids is reversed have the same structure as the original protein?1) Explain the meanings of the "Motif" and "Domain" in the structuralhierarchy of proteins. Which structural groups can domains beclassified into? Give examples of and illustrate with diagrams at least4 simple protein motifs. 2) Explain the meaning of protein family, superfamily and fold. How dothese reflect structural and evolutionary relatedness?Discuss and identify the four levels of protein structure (primary, secondary, tertiary,and quaternary). Explain how the structure of a protein affects its properties and howdenaturation changes the structure.
- Theoretically, a protein could assume avirtually infinite number of configurations and conformations.Suggest several features of proteins that drastically limit theactual numberBiochemists talk about protein structure at four distinct levels: primary, secondary, tertiary and quaternary structure. Below are depictions of each of these levels of protein structure. For each image, match the term and the written description of the level of protein structure that the image depicts. Drag the appropriate items to their respective bins.In general, proteins can be classified into 3 different groups. Name and give a short description of each type and how they are distinct from one another. Provide an example of macromolecule or other complex structure representing each of the three types.
- 1.Describe in detail how to determine the primary structure of protein. 2.You have been given a mixture of lysine, histidine and cysteine.The isoelectric point of the amino acids are as follows; histidine 7.64 lysine:9.74 cysteine:5.02 Show how you will separate the mixture into the pure forms. State and describe any instrument that you will use to separate the components in the mixture.What life uses proteins for? (functions of proteins) Describe protein structures. Describe the alpha helix and the beta sheet structure of proteins. Which structure is the most important in the function of a protein? Describe what can affect the protein structure. Why the structure of a protein is important?Protein structure: a). Name the four levels of protein structure, b). Describe the structural characteristics at each level, C. For one protein describe how "A" and "B produce the effects that the protein produces
