Three polypeptides, the sequences of which are represented using the one-letter code for their amino acids, are present in a mixture: Peptide 1: ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG Peptide 2: GPYFGDEPLDVHDEPEEG Peptide 3: PHLLSAWKGMEGVGKSQSFAALIVILA Determine which peptide would migrate most slowly during the given methods of chromatography. anion exchange chromatography cation exchange chromatography size-exclusion (gel-filtration) chromatography Peptide 1 Answer Bank Peptide 2 Peptide 3

Q: can you write out/or draw the steps of cellular respiration.  Include all phases, glycolysis, kreb,…

A: Introduction  The process of cellular respiration involves the oxidation of biological fuels in the…

Q: Looking at the chart explain why a patient with blood high cholesterol levels would be prescribed an…

A: Cholesterol is a lipid molecule that is hydrophobic in nature. As a result the solubility of…

Q: 5. This kingdom consists of the simplest organisms; these organisms can live nearly everywhere O…

A: Introduction  Kingdom is ranked just behind domain in the study of taxonomy. The lower levels of…

Q: innaeus Baptiste de Lamarck tle as Malthus created a binomial nomenclatu [Choose ] [Choose ] [Choose…

A: Robert huk was a first to identify a cell in 1665. He observed the cork cell. Cork is the part of…

Q: Choosing one neurotransmitter, discuss neurotransmission from synthesis to release in the…

A: Neurotransmitters are chemical messengers released by neurons for transmitting signals from nerve…

Q: A microbiologist is working in a clinical laboratory handling samples for the detection of…

A: Biosafety levels are protective measures that are needed while working in a laboratory for the…

Q: Can you explain why this is unusal?

A: Gene expression is frequently a complicated process, and the phenotypes we observe are the…

Q: what is the term that describes an element that is "locked away" (perhaps deep underground in a…

A: Biogeochemical cycle  The cycle of elements like carbon oxygen etc from biotic factors to abiotic…

Q: Are viruses living? Discuss based from the properties of life in Biology.

A: Introduction  A virus is an infectious microorganism made up of a protein-coated segment of nucleic…

Q: COVID

A:

Q: An Inventory of My Traits: Data Table Yes med Tongue Rolling Dimples Right Handed Freckles Naturally…

A: Most commonly the trait that is present in larger percentage of people usually is dominant over the…

Q: All can be said of dendrites, EXCEPT: they must grow in size to be able to "learn" undergo…

A: Dendrites are finger-shaped cells located at the end of each neuron. The dendrites are small but…

Q: Consider a hypothetical amino acid whose side chain forms a hydrogen bond with the oxygen atom of a…

A: Introduction:- Proteins are made up of molecules called amino acids. Proteins and amino acids are…

Q: Type of Solutes Non-permeable Permeable Solution A 300 0 Solution B 295 20 Solution C 270 30…

A: Osmosis : Movement of solvent molecules or water molecules from a region of low concentration or…

Q: In Dictyostelium, cheats must modify their behavior when in a chimera to take advantage of their…

A: Dictyostelium sp. forms when amoeba run out of its food and aggregate in the form of a motile slug.…

Q: Describe the process of neural integration. What happens when a neuron receives both inhibitory and…

A: Neuron  The special type of cell found in higher organisms which carry electrochemical impulse from…

Q: Which of the following people do NOT need to be tested for their bone mineral density? Group of…

A: The functions of bones are to provide the body with correct structure, to protect internal organs to…

Q: Terrestrial Biomes Which terrestrial biome is the most common along the equator? O Chapparal O…

A: Introduction :- The arctic, temperate woods and grasslands, chaparral, temperate and tropical…

Q: any living to living interactions with their benefit to each other?

A: Interaction   In ecology,  interaction means how one organism reacts in the presence of another.

Q: Which answer choice best describes the following claim? • Genetically modified wheat is an…

A: Most genetically modified organisms are employed as "models" in laboratory studies to investigate…

Q: On the histological section of one of the endocrine glands visible rounded structures of various…

A: The thyroid, or thyroid gland, is an endocrine gland in vertebrates. In humans it is in the neck and…

Q: What problem would be caused by moving the beaker during the devlopment of the chromatogram?

A: Chromatography is the technique of laboratory in which separation of mixture takes place from it's…

Q: What is the role of the respiratory pump?

A: Respiratory system It is your body's network of tissues and organs that aids in breathing .  Your…

Q: 12, Name the three main plexuses and the major nerves derived from each.

A: A nerve plexus is a plexus (branching network) of intersecting nerves. A nerve plexus is composed of…

Q: Make a simple poster that shows how to take care of your respiratory and circulatory systems, and…

A: Introduction   It is crucial to take care of our health because when we are healthy, we may live…

Q: Your microbiologist friend isolated two new bacteria and stored them in separate tubes. One…

A: Ecological adaptations is the quality of an organism of having specialised features that enhances…

Q: Convert a dose of 136 mL for a 99 pound patient to mL/lb (milliliters per pound) , rounded to 1…

A: The doses are designed to work in specific concentrations. Hence Calculation of doses is often…

Q: How many combinations of DNA bases are for a polynucleotide of 7 base pairs in length?

A: DNA  The genetic material or genome of an organism. Most of the organism have DNA as genetic…

Q: 10. Many presynaptic action potentials are needed in a process called summation. Explain what…

A: Introduction - Presynaptic neurons release neurotransmitters into the synapse, causing post-synaptic…

Q: 8.27 x 11.69 in 5 / 7 Taxonomy O Kingdoms of Classification k I Binomial Nomenclature Cladistics…

A: Introduction: There are numerous types of plants and animals in the living world. The structural and…

Q: 2) Why does the plant breeder in the following scenario committed an experimental error? "A plant…

A: Any scientific experiment should be in replicative manner with variation and bias-free. Replication…

Q: Discuss how human impact on the environment that could lead to a change in an organism's DNA and…

A: * DNA is the genetic material which stores genetic information of the cell. * Humans and their…

Q: Briefly explain the difference between Wright Staining and H&E Staining (why use one over the other)

A: Staining is defined as a technique ,which is utilized for increasing the contrast in biological…

Q: Define the term pathophysiology?

A: Introduction: Disease is any adverse variation from an organism's normal structural or functional…

Q: Would a tree inside a forest fragment, 275 meters in from the edge, be susceptible to edge effects?…

A: Edge effects in ecology are modifications to population or community structure that take place along…

Q: Home Tools 6weekwomensfull... Nelson Biology 11... ↓↓ 8.27 x 11.69 i 3 / 7 Unit 1- Quiz on Le... x…

A: Introduction :- Eubacteria are prokaryotic microorganisms made up of a single cell without a nucleus…

Q: Differentiate the types of necrosis.

A: Introduction :  Necrosis is a form of cellular death that takes place when cells are exposed to…

Q: How might differences in enzyme concentrations affect rates of photosynthesis and respiration?

A: Photosynthesis is the process by which carbon dioxide and water are converted into oxygen and…

Q: How does the nucleus structure relate to its function & so they it can do? Example in photo

A: In 1665, Robert Hooke discovered plant cell walls in cork slices, which was rapidly followed by…

Q: Which of the following statements regarding "start" and "stop" signals apply to both transcription…

A: Introduction  A two-step technique is used to express the genes that code for proteins. A gene's DNA…

Q: 3. Explain how the equations for photosynthesis and cellular respiration can be compared.

A: 3) Photosynthesis and cellular respiration are two completely different process. Photosynthesis: CO2…

Q: Based on your knowledge of oxidative phosphorylation, explain why there is an increase in…

A: The process of oxidative phosphorylation is referred as a redox reaction that involves the transfer…

Q: # of respondents 35 30 20 10 5 0 An Inventory of My Traits: Data Table Yes No Detached Tongue…

A: Introduction A trait is a distinguishing feature or characteristic, which generally belongs to a…

Q: Which type of niche does this riddle describe? "This niche does not change for an individual…

A: Explanation:  A realized niche refers to the conditions that a particular animal (population,…

Q: II. A diploid species has 3 pairs of chromosomes in the somatic cells. In males, the first pair is…

A: Introduction :- Tetraploidy, which refers to a cell having four identical sets of chromosomes, is…

Q: Which of the following are features of proteins? -they are generally circular molecules. -they are…

A: Proteins are made up of hundreds or thousands of smaller units called amino acids, which are…

Q: Terrestrial Biomes Which is the largest terrestrial biome? Chapparal O Desert O Northern Coniferous…

A: * A biome is a large area which is  characterized by  its vegetation and climate and  soil and…

Q: 2. Describe the structure of neurons and the function of their components. Describe the location,…

A: The functional unit of nervous system is called neurons. The size varies from 4 to 100 microns. The…

Q: 2. What two processes unique to meiosis are responsible for genetic variation? At what point in…

A: >> The two process unique to meiosis that are responsible for genetic variation are…

Q: Student's last name Hormones of endocrine glands (continuation) Date Stimulating Pri

A: Endocrine glands are ductless glands and they release their hormones directly into the blood.

Proteins

We generally tend to think of proteins only from a dietary lens, as a component of what we eat. However, they are among the most important and abundant organic macromolecules in the human body, with diverse structures and functions. Every cell contains thousands and thousands of proteins, each with specific functions. Some help in the formation of cellular membrane or walls, some help the cell to move, others act as messages or signals and flow seamlessly from one cell to another, carrying information.  

Protein Expression

The method by which living organisms synthesize proteins and further modify and regulate them is called protein expression. Protein expression plays a significant role in several types of research and is highly utilized in molecular biology, biochemistry, and protein research laboratories.