Q: Question:- 7. How do electrons interact with biological specimens? Advantages and disadvantages.
A: "All living organisms are made up of cells, which are the basic building components." They support…
Q: 7) What are adipocytes? 8) Define the following terms: a. Hydrophobic
A: The cell is the term generally defined to mean that they are a primarily structural and well-stated…
Q: Select the correct statement about endogenous retroviruses * Take up to 8% of the human chromosomes…
A: Viruses Viruses are microorganisms that are non-living until and unless they find specific host…
Q: Noisy begging by nestlings to be fed by a parent is said to be an honest signal when it entails high…
A: Nestling begging Nestling beg for parental care, security and food. But this can attract attention…
Q: tes, the net ATP produced from glycolysis to aerobic respiration is 36 while in prokaryotes is 38.…
A: The chemicals produced by anaerobic respiration in bacteria are known as adenosine triphosphates.…
Q: Explain how light interacts with an object. 3. What are the properties of water that make it…
A: 2. Light interacts with objects in either of the two ways. It can either be Emitted Absorbed…
Q: 1. What is the difference between scanning and electron microscopy?
A: Microscopy It is defined as the field of utilization of microscopes to see objects and substances…
Q: Cancer stem cells (CSCs) are cancer cells (found within tumors or hematological cancers) that…
A: Cancer stem cells are uncommon perpetual cells that possess several properties such as…
Q: Analyze and research human disease, transmission and treatment that can and does result in a huge…
A: Diseases transmission Transmission of diseases in general words is defined as the spread of a…
Q: Explain why the large, steroid hormone, estradiol (MW 272) readily crosses membranes by simple…
A: Hormones are signaling molecules that act as chemical messengers. They are secreted by endocrine…
Q: Recently, consumption of trans fatty acids has been linked to high blood cholesterol levels and…
A: Introduction: The saturated fatty acids (cis) obtained from both animal fats and plant oils. they…
Q: e colonial morphology of the colonies shown below. A full description will include texture,…
A: Microorganisms must be grown outside of the body in order to examine their traits and properties for…
Q: A body is found submerged with the facial bones exposed, torso with some bone exposure, and bones of…
A: The stage 4 of decomposition i.e. skeletonization is the condition here as per the given…
Q: How would you describe what flow cytometry is to someone who has no specific science training?…
A: Flow cytometry is a technology that provides rapid multi-parametric analysis of single cells in…
Q: In dogs, albino white coat color is an autosomal recessive trait, while black coat is a dominant…
A: Autosomal recessive trait Autosomal traits are those that are controlled by somatic cells (not the…
Q: Based on the diagram given , the smallest monophyletic grouping that includes Species D and G is -…
A: Introduction: Monophyletic taxon : monophyletic taxon is also called a clade. shares a single…
Q: Arrange the following from first event to the last of odontogenesis -DENTINOGENESIS -AMELOGENESIS…
A: Introduction Odontogenesis:- It is the medical term used to describe the complex biological process…
Q: Explain the methodology, rationale, and challenges in the control of Triatomine vectors.
A: Answer :- Control campaigns victimization residual pesticides against domestic triatomines…
Q: 41. In acute prostatitis, an exam of the prostate may find the gland to be: A. Nodular B. Cool and…
A: Please follow step 2 for detailed explanation.
Q: Justify the use of a Restricted Application Protocol (RAP) in the control of human African…
A: Given that human African trypanosomiasis is a serious and debilitating disease, it is important to…
Q: To maintain our body tissues with enough carbohydrate intake must be a. 50-100g b. 50-150g c.10-50g…
A: I gave you the answers below. As per our guideline i can answer only first three questions but i…
Q: 1 Which chemotaxonomic markers will consider in Polyphasic taxonomy?
A: Bacterial phylogenetic trees can be constructed using the small ribosomal RNA sequences and it helps…
Q: If undetected, PDC deficiency can be lethal because O a. All of the above O b. diabetic ketoacidosis…
A: Neurodegenerative disorders Neurodegenerative disorders are uncurable diseases that affect the nerve…
Q: Question 8. Suppose species in old clades were more likely to go extinct. How would this change the…
A: Considering speciation and rate of extinction as high for older clades, species rich diversity…
Q: Fill in the blanks. Provide 3 answers for the constant (add to make it 3). Problem: Do homeworks…
A: Experimental variables These variables are determined by the metadata of each experiments. There are…
Q: Which result occurs when an enzyme-catalyzed reaction is heated to a few degrees above its maximum…
A: Enzymes are biocatalyst. Enzyme speed up the reaction.
Q: What are the requirements for the lac operon to be actively transcribed? a. Glucose and lactose…
A: Operons are the group of genes which are transcribed under a single promoter. These are found in…
Q: What is the probability of 1) Having an affected daughter? 2) having an affected son?
A: As previously mentioned the mode of inheritance is X - Linked dominant. X-linked dominant…
Q: Given a positive genetic correlation between the lengths of the maxilla and the mandible of a bird…
A: Positive correlation and pleiotropic effects.
Q: dramatically
A: The DNA sequence undergo into transcription to form the mRNA , and this mRNA then undergo into…
Q: Some extreme environments where archaea and bacteria are found.
A: Bacteria and Archaea Bacteria and archaea are single called mucro-organisms belonging to domain…
Q: What are the usage and basis of the Biolog test and FGA techniques ?
A: Biology provides various aspects of life , helped the modern human beings in the improvements in…
Q: Conventional signals are not costly because they often entail slight visible variations in only a…
A: D.Female chimps will not mate with a male defeated in combat.
Q: What are the evolutionary and biogeographical significance of the discovery of Homo luzonensis
A: The earliest of species to have found existed was Homo luzonensis, a proof that the previous human…
Q: How does gene affects migrating cells?
A: Solution:- Firstly we can see what is migrating cells and which factor affect the cell migrating.…
Q: A predators can feed on several prey species, but prefer to attack those with the weakest defenses.…
A: Ecological relationships among the species.
Q: Which of the following DNA repair pathways repair DNA double strand breakage that only occur in…
A: ANSWER) (D) non-homologous end joining (NHEJ) NHEJ or non-homologous end joining is a pathway which…
Q: Biology Which of the following is NOT a requirement of natural selection?
A: Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: The somatic nervous system provides both excitatory and inhibitory signals t skeletal muscle. True…
A: Neurons are the structural and functional units of the nervous system. A neuron consists of the…
Q: In an experiment in which resource allocation was studied in ovariectomized and sham-operated brown…
A: The correct answer is - B. Allocation to reproduction enhanced the growth and survival of the brown…
Q: plot size = 0.96 ft (in other words, 0.96 feet squared) Price Valley UPLANDS (lowlands-listed…
A: Biomass Biomass is the mass of living organisms like plants, animals, and microorganisms.
Q: Sexual reproduction in unpredictable environments provide immediate benefits to individuals…
A: Sexual reproduction is the type of reproduction which results in variations in the offsprings. Such…
Q: Expenditure of energy that is dependent on body weight, sex, age due to a. basal metabolic rate b.…
A: 1) c physical activity 2) a. Basal metabolic rate Your basal metabolic rate (BMR) is the minimum…
Q: A Patients with an inherited cancer have a mutation in a zinc-finger motif of P21 (a cell-cycle…
A: Each organism's DNA sequence is unique. Its base-pair sequence might vary from time to time. It is…
Q: (1) Parts of a Neuron A Axon (initial B segment) G H Synapse: The region where an axon terminal…
A: Introduction The given diagram shows how action potentials can travel long distances within a single…
Q: Can someone explain the concept behind a sample that lies in the UV range in a spectrophotometer?…
A: UV spectroscopy or UV–visible spectrophotometry refers to absorption spectroscopy or reflectance…
Q: One of the reasons why phage therapy has not been applied widely is that bacteria can become…
A: Phage therapy is on the experimental stage still. In this therapy, bacteriophages are used to kill…
Q: According to the passage, what is the probable effect of growing insectivorous plants in richer…
A: Plants do adaptive behaviour to survive in various adverse conditions as in case of low nitrogen…
Q: In a phylogenetic tree, Species 1 and 2 are distantly related to one another but are both darkly…
A: Q. In a phylogenetic tree, Species 1 and 2 are distantly related to one another but are both darkly…
Q: Compare and Contrast Monocot seeds and Dicot seeds
A: A seed is an embryonic plant that is generally stated and defined that they are surrounded by a…
Step by step
Solved in 2 steps
- SspI --- 5' AAT - ATT 3'5' GGATAATATT GTTAACAATCTCTACGGGTTAACACCCTTGGAATATTTTAA 3' 3' CCTATTATAACAATTGTTAGAGATGCCCAATTGTGGGAACCTTATAAAATT 5' Number of pieces of DNA _______Why D is wrong?HindII --- 5' GTC - GAC 3', HaeIII --- 5' CC - GG 3', EcoRI --- 5' G - AATTC 3' and BamI --- 5' CCTAG - G 3' 5' AGAATTCTTACGCCGGACGTACCTAGGTTTAGTCGACTC CGCCGCCCCTAGGGTCATCA 3' 3' TCTTAAGAATGCGGCCTGCATGGATCCAAATCAGCTGAGGCGGCGGGGATCCCAGTAGT 5' Number of pieces of DNA , and blunt end fragment (s), and sticky end fragment(s)
- Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?#3 HaelII --- 5’ CC ↓ GG 3’ 5’ ACGCCGGCCGTATTAT CCGGATCCGCCG CCGGCTGTCCCGGATCA 3’ 3’ TGCGGCCGGCATAATAGGCCTAGGCGGCGGCCGACAGGGCCTAGT 5’ Restriction enzyme: Recognition sequence: Number of pieces of DNA: Type of cut:Someone that can help me with plotting OD450 against time??