You study the expression of the hexose kinase gene and capture the following electron micrograph ofthe gene being expressed.MRNA120ORI403'60TTCGAGCTCTCGTCGTCGAGATACGCGATGAIAAGCTCGAGAGCAGCAGCTCТАTGCGCTACТАТААТGACCАТТАТАСЕССТАCGTGATAG5'SATATTTТАСTGGIAAТАТЄGGGATGCАСТАТСpromoterRNApolymerasePractice Question 4D) Will translation stop at the UAA which begins at position 33? Explain your logic.ribosome

Name: You study the expression of the hexose kinase gene and capture the fo
Uploaded: 2024-03-20T06:42:41.000Z
Channel: Bartleby
Description: You study the expression of the hexose kinase gene and capture the following electron micrograph ofthe gene being expressed.MRNA120ORI403'60TTCGAGCTCTCGTCGTCGAGATACGCGATGAIAAGCTCGAGAGCAGCAGCTCТАTGCGCTACТАТААТGACCАТТАТАСЕССТАCGTGATAG5'SATATTTТАСTGGIA

Translation is the process of formation of a sequence of amino acids using messenger RNA as a…

Answered: You study the expression of the hexose…

Science

Biology

You study the expression of the hexose kinase gene and capture the following electron micrograph of the gene being expressed.

Concepts of Biology

1st Edition

ISBN:9781938168116

Author:Samantha Fowler, Rebecca Roush, James Wise

Publisher:Samantha Fowler, Rebecca Roush, James Wise

Chapter9: Molecular Biology

Section: Chapter Questions

Problem 10RQ: Control of gene expression in eukaryotic cells occurs at which level(s)? a. only the transcriptional...

See similar textbooks

Similar questions

5’ATCGCGCTAGGCGCATGCTACCTAGGCTATCTGCCTAGCTATCGACTAATCTGATCGAGTCAG3’ 3’TAGCGCGATCCGCGTACGATGGATCCGATAGACGGATCGATAGCTGATTAGACTAGCTCAGTC5’ Write out the pre-mRNA for this geneWrite out the mRNA for this geneHow many amino acids does this protein have? Translate the protein Label your 5’ and 3’ UTR’s
Control of gene expression in eukaryotic cells occurs at which level(s)? a. only the transcriptional level b. epigenetic and transcriptional levels c. epigenetic, transcriptional, and translational levels d. epigenetic, transcriptional, post-transcriptional, translational, and post-translational levels
GTTTTCACTGGCGAGCGTCATCTTCCTACT 8. What is the function (e.g. transcriptional regulation, transmembrane signaling, kinase, protease, etc.) of the protein(s) encoded by the gene.
. In an effort to determine the location of an operator sitefor a negatively regulated gene, you have made a seriesof deletions within the regulatory region. The extent ofeach deletion is shown by the line underneath the sequence, and the resulting expression from the operon(i = inducible; c = constitutive; − = no expression) isalso indicated.... GGAT C T T AGCCGGCTAACATGATAAATATAA......C C T AGAATCGGCCGA TTGTA C T A TTT ATAT T ...1 i2 –3 c4 –5 ca. What can you conclude from these data about thelocation of the operator site?b. Why do you think deletions 2 and 4 show no expression of the gene?
Given the following schematic for a gene and its associated regulatory regions, answer the following questions by placing the correct letter in the provided blanks please put in the correct letter for the questions What region would provide cell type-specific expression of genes? region What site would significantly increase gene expression rates? = region What region or regions of this gene’s coding sequence are expressed as amino acids = region
These sequences are derived from the middle region of the covid-19 spike protein. Which choice or choices would not have m/z signature(s) that would allow them to be identified as tryptic peptide(s)? YNENGTITDAVDCALDPLSETK VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEK RVQPTESIV
GGGAGTGTATACGGGATGAAGGCGATT MRNA What’s the Protein And what’s the phenotype
Based on its sequence similarity to Apobec1,which deaminates Cs to Us in RNA, activation-induceddeaminase (AID) was originally proposed to work on RNA.But definitive experiments in E. coli demonstrated thatAID deaminates Cs to Us in DNA. The authors of the paperexpressed AID in bacteria and followed mutations in aselectable gene. They found that AID expression increasedmutations about fivefold above the background level inthe absence of AID expression. More importantly, theyfound that 80% of the induced mutations were G→A orC→T. Does this fit with your expectation if AID-inducedmutations arose by deamination of C to U in the DNA?
The TBX20 transcription factor is important for the developmentof heart tissue. Deletion of the Tbx20 gene in mice results in poorheart development and the death of mice well before birth. Tobetter understand how TBX20 regulates heart development ata genetic level, Sakabe et al. (2012. Hum. Mol. Genet. 21:2194–2204) performed a transcriptome analysis in which they comparedthe levels of all mRNAs between heart cells from wild-typemice and mice with Tbx20 deleted. This study concluded that TBX20 acts as an activator ofsome genes but a repressor of other genes in cardiac tissue.How might a single transcription factor have oppositeeffects on the transcription of different genes?
CTA GCC CTC CGT TAC TAG TTA CCT ACT TAT TCA ATT TTG TAA ACG CTC ATC CGA ACC CGC TTT TAA TTG CCC ACT TAG TCG ATT ACC CGT TTA TGT TAA TTA CCT ATC 1. Build the mRNA molecule matching the RNA nucleotides to the DNA nucleotides properly letter by letter. (assume that the mRNA is bacterial there are not intros to cut out)
For each of the terms in the left column, choose thebest matching phrase in the right column.a. basal factors 1. organizes enhancer/promoter interactionsb. repressors 2. pattern of expressiondepends on which parenttransmitted the allelec. CpG 3. activates gene transcriptiontemporal- and tissue-specificallyd. imprinting 4. site of DNA methylatione. miRNA 5. identifies DNA-binding sitesof transcription factorsf. coactivators 6. bind to enhancersg. epigenetic effect 7. bind to promotersh. insulator 8. bind to activatorsi. enhancer 9. prevents or reduces geneexpression posttranscriptionallyj. ChIP-Seq 10. heritable change in geneexpression not caused byDNA sequence mutation
Put the following steps in the correct orderedsequence.a. kinase cascadeb. activation of a transcription factorc. hormone binds transmembrane receptord. expression of target genes in the nucleuse. Ras molecular switch