Which of the following is the correct answer and why!? Thanks in advance iso İSÜ - Sınav Ekranı - ALMSi istinye.almscloud.com ExamUser/TakelexamSessionidRef BEOA6673AF09BBCCAS84AA7. hafta(7,00 Puanlar)17- Which of the following mutated proteins is most likely to cause a cell to become cancerous?a) OAn overactive version of a protein that promotes apoptosisb) OAn underactive version of a protein that stimulates growth hormone receptorsc) OAn underactive version of a protein that promotes cell cycle progressiond) O An overactive version of a protein that stimulates cell divisionO Boş bırak< Önceki17/20Sqngaki >КаptV Sınav

Cancer cells differ from the normal cells of the body in many ways as normal cells become cancerous…

(7,00 Puanlar) 17- Which of the following mutated proteins is most likely to cause a cell to become cancerous? a) An overactive version of a protein that promotes apoptosis b) O An underactive version of a protein that stimulates growth hormone receptors An underactive version of a protein that promotes cell cycle progression d) O An overactive version of a protein that stimulates cell division O Boş bırak

(7,00 Puanlar) 17- Which of the following mutated proteins is most likely to cause a cell to become cancerous? a) An overactive version of a protein that promotes apoptosis b) O An underactive version of a protein that stimulates growth hormone receptors An underactive version of a protein that promotes cell cycle progression d) O An overactive version of a protein that stimulates cell division O Boş bırak

An Illustrated Guide To Vet Med Term

4th Edition

ISBN:9781305465763

Author:ROMICH

Publisher:ROMICH

Chapter10: Skin Deep

Section: Chapter Questions

Problem 1CTE

See similar textbooks

Similar questions

How many nucleotides would be necessary to code for 10 amino acids? Please help, I am lost!
Below is a primary sequence alignment between the wild-type hemoglobin protein, and the hemoglobin mutant that causes sickle-cell anemia. Please look at the alignment and select the correct answer below. wt_hemoglobin: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 sickle_cell: MVHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 ****** ***************************************************** wt_hemoglobin: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 sickle_cell: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 ************************************************************ wt_hemoglobin: KEFTPPVQAAYQKVVAGVANALAHKYH 147 sickle_cell: KEFTPPVQAAYQKVVAGVANALAHKYH 147 Answers: A) The observed mutation is a negatively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold B) The observed mutation is a negatively charged to a polar amino acid. Such a change…
Hello can someone help me to fill in the chart using the webpage I'm proving thank you so much https://courses.lumenlearning.com/suny-bio2labs/chapter/reading-
EcoRI --- 5' G - AATTC 3' 5' AGAATTCCGACGTATTAGAATTCTTAT CCGCCGCCGGAATTCT CATCA 3' 3' TCTTAAGGCTGCATAATCTTAAGAATAGGCGGCGGCCTTAAGAGTAGT 5' Number of pieces of DNA , and type of fragment .
Would love a list of different types of nucleotide repeat disorders. Thank you!
I don’t remember how to find the mutation.
I just don't know how to get the answer for C and D. Expecially for C, why F+died because of leu-?
any biochemistry expect please help me.
Please answer correctly, and provide proper solutions and explanations from A to E. Thank youuuu
UPVOTE WILL BE GIVEN! ANSWER IN 3-5 PARAGRAPHS (TYPEWRITTEN) a. What are the applications of modern biotechnology in the field of engineering? b. What are the implications of these applications? c. How do you think these applications will change the world in the future?
I was wondering if it is possible to provide an explanation on the structure of the PDB code 2V1X, the amino acid at position 219 and the mutation of the amino acid name LU. Thank you.
I dont know the type of mutation and pls kindly answer this properly