Below is a primary sequence alignment between the wild-type hemoglobin protein, and the hemoglobin mutant that causes sickle-cell anemia. Please look at the alignment and select the correct answer below. wt_hemoglobin: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 sickle_cell: MVHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60 * wt_hemoglobin: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 sickle_cell: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120 ************** wt_hemoglobin: KEFTPPVQAAYQKVVAGVANALAHKYH 147 sickle_cell: KEFTPPVQAAYQKVVAGVANALAHKYH 147 Answers: A) The observed mutation is a negatively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold B) The observed mutation is a negatively charged to a polar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold C) The observed mutation is a positively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold D) The observed mutation is a nonpolar to a negatively charged amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold E) The observed mutation is a polar uncharged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold

Medical Terminology for Health Professions, Spiral bound Version (MindTap Course List)

8th Edition

ISBN:9781305634350

Author:Ann Ehrlich, Carol L. Schroeder, Laura Ehrlich, Katrina A. Schroeder

Publisher:Ann Ehrlich, Carol L. Schroeder, Laura Ehrlich, Katrina A. Schroeder

Chapter6: The Lymphatic And Immune Systems

Section: Chapter Questions

Problem 41LE

See similar textbooks

Related questions

Concept explainers

Question

Below is a primary sequence alignment between the wild-type hemoglobin protein, and the hemoglobin mutant that causes sickle-cell anemia. Please look at the alignment and select the correct answer below.

wt_hemoglobin: MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60

sickle_cell: MVHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK 60

****** *****************************************************

wt_hemoglobin: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120

sickle_cell: VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG 120

************************************************************

wt_hemoglobin: KEFTPPVQAAYQKVVAGVANALAHKYH 147

sickle_cell: KEFTPPVQAAYQKVVAGVANALAHKYH 147

Answers:

A) The observed mutation is a negatively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold

B) The observed mutation is a negatively charged to a polar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold

C) The observed mutation is a positively charged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold

D) The observed mutation is a nonpolar to a negatively charged amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold

E) The observed mutation is a polar uncharged to a nonpolar amino acid. Such a change dramatically changes the local environment, causing the protein to mis-fold

Expert Solution

Trending now

This is a popular solution!

Step by step

Solved in 3 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.