Analyse and interpret the SCAM data in Fig. 1, and make a table (remember to include a legend) to indicate where each amino acid is located (cytoplasm, membrane, periplasm).
Q: s) In two experiments carried out in a research lab, an enzyme reaction is run with and without an…
A: Enzymes are proteins that catalyze biochemical reactions. They contain an active site where the…
Q: ATP Hydrolysis: ATP to ADP+Pi Given that the standard free energy change of ATP hydrolysis is…
A: The mathematical relation between actual free energy change (ΔG) and biochemical standard free…
Q: Genetics Q3
A: The objective of this question is to identify the recombinant offspring and calculate the…
Q: Genetics Question 4 How would I do this with multiple punnet squares?
A: The objective of the question is to understand how to use multiple Punnett squares to solve…
Q: You are studying how your Lys-Val-Thr tripep de interacts with another pep de, which places an Asp…
A: Eventhough all ionizable groups have their characteristic pKa value, the pKa value of an ionizable…
Q: Given below is the mRNA sequence that encodes the amino acids of a protein. Based on the mRNA…
A: ● To figure out the protein sequence from mRNA sequence we need to use a codon table where 3 bases…
Q: To track cell growth and utilization of the limiting substrate in a bioreactor, the yield is…
A: S=Y(X0−S0)X−X0+S0Explanation:Lag Phase: The growth rate is zero (μ = 0) since there is no…
Q: Question 7
A: The question is asking about the capabilities of stem cells, specifically whether they can divide,…
Q: An engineered ligand binds its target with 5 nM affinity at high pH. However, protonation of a…
A: An engineered ligand (L) binds to a target protein (T) to form a ligand:target complex (LT). The…
Q: Question 1: Look at table 17.2 to see the standard free energy changes for the steps in the CAC.…
A: Citric acid cycle is also called tricarboxylic acid cycle or TCA cycle or Krebs cycle. This is the…
Q: Which of the following amino acid groups has the least propensity to be present in a beta turn?…
A: Amino acids are the biomolecule that forms protein. There are 20 amino acids, having same basic…
Q: Draw the amino acid below in its most protonated form, any intermediately protonated forms, and its…
A: pH = 1/Log [H+] If [H+] concentration in a solution is high, pH will be low and the solution is…
Q: An incomplete structure of a porphyrin ring is shown below. The structure is missing three pi bonds…
A: Porphyrin molecules are a popular biological moiety with applications in pharmaceutical chemistry,…
Q: Calculate the percentage of the peptides synthesized that will be full length and have the correct…
A: The effectiveness of each step i.e. adding of an amino acid residue in Merrifield solid phase…
Q: Question 2 Listen The ABO gene is on a different chromosome from the +/- (Rh factor) gene. What…
A: The objective of the question is to determine the correct genetic designation for a person with O…
Q: Onlyqno3 solve. I. Given a polypeptide below, answer the following questions:…
A: Proteins are polymers of amino acid residues linked together via peptide bonds and folded into a…
Q: After running a qPCR experiment, we will have graphs showing the amount of fluorescence detected by…
A: The Polymerase Chain Reaction is a qualitative procedure which is used to produce large copies of…
Q: Produces Leaves the nucleus and goes to the... 7. Transcription and Translation---DNA: A A…
A: Piece's of RNA make amino acids, which make proteins and this process occurs in the Cytoplasm. m RNA…
Q: Rate in U [S] in mM No Inhibitor 0.5 1.0 2.0 4.0 8.0 16.0 32.0 64.0 0.22 0.41 0.73 1.12 1.57 2.01…
A: The Michaelis-Menten kinetics is the simplest and best model to understand enzyme kinetics, and it…
Q: 2. What is a checkpoint? Give an example and say what happens at that checkpoint.
A: The objective of this question is to understand the concept of a checkpoint in the context of…
Q: Choose the False statement about the parameters that quantitate enzyme catalysis A. V max is the…
A: Enzymes are biological catalysts that increase the rate of biochemical reactions.Most enzymes are…
Q: 7. Do Km and Vmax get affected by available substrate concentration? Explain.
A: Enzymes are high molecular-weight protein molecules that catalyse biochemical reactions. The…
Q: The data in the table are used to create a calibration curve for the determination of RNA from ts…
A: The 'least square method' is an alternate name for the linear regression model of statistical…
Q: Assume that an enzyme-catalyzed reaction follows the scheme shown: E + S ES E + P k₁ = 1 x 10%/M-s…
A: Michaelis Menten postulated that free enzyme reacts with the substrate reversibly to form an…
Q: -OH + HO + H2O + CO2
A:
Q: Please describe what is a peptide bond? What is the significance of the amino terminus versus the…
A: Proteins are biomolecules which show great diversity in their structure and functions with Amino…
Q: 22. For the process, A B, Keq is 0.02 at 37°C. For the process, BC, Keq 1000 at 37°C. A. Determine…
A: The objective of the question is to determine the equilibrium constant for the overall process A…
Q: Draw a mechanism to account for the inter-strand cross linkage of two guanines by busulfan. Explain…
A: Busulfan is a drug used to treat cancer. It can form inter-strand crosslinks between guanine species…
Q: Directions: Answer the following as directed: vinu oto de 00 200nsko2 brs 2nA lo epello 1. After…
A: Amino acids are building blocks of proteins, which have three different chemical groups: an amino…
Q: How many dissociable protons are present in Tris buffer? How did you come to this conclusion?…
A: Tris buffer is also known as tris(hydroxymethyl)aminomethane. It is an organic compound with the…
Q: Q5. A sh mutant called shXS is isolated that produces a truncated polypeptide of only 6 AAs in…
A: The objective of the first question is to identify a single basepair DNA change that would lead to a…
Q: a particular enzyme catalyzes a single reactant S to a single product P, following michaelis-menten…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: BME (high concentration) disrupts O Disulfide linkages Accelerating disulfide cross-linking. Olonic…
A: BME stands for beta-mercaptoethanol. It is a chemical compound. It can act as a biological…
Q: Exercise 10 & 11: Carbohydrate catabolism in general - primarily looking at fermentation paths in…
A: Catabolism and anabolism are two fundamental processes involved in the metabolism of organic…
Q: D raw the full structure of the following tetrapeptide . Label the N terminal and C terminal…
A: An amino acid is a biomolecule that has a hydrogen atom, an amino group, a carboxyl group and a…
Q: A patient suffers severe tachycardia upon consuming even a small amount of alcohol. What enzymatic…
A: Tachycardia is defined as the increased heart rate which is characterised by more than 100 beats per…
Q: Along the pathway shown belour for a reaution when Est represents on enzyme bound transition state,…
A: The state that is attained by the substrates through a molecular arrangement during a reaction. This…
Q: In the following graph, enter the number of the curve that corresponds to each of the following…
A: Enzyme inhibition occurs when certain substances also called inhibitors, bind to and inactivate…
Q: How many TCA cycles required to fully oxidize 1 molecule Acetyl-CoA. Support your answer with…
A: There are two oxidizable carbons in acetyl-CoA; the methyl carbon (CH3-) and the carbonyl carbon…
Q: Imagine a typical enzyme kinetic curve of [S] vs. V. The maximum [S] is about four times the Km.…
A: 1. Vmax: A parameter in enzyme kinetics, maximum velocity, or Vmax for short, is the fastest rate at…
Q: When the CAC is run in reverse by microorganisms that use it to fix carbon, the citrate synthase…
A: Kreb cycle is the reaction procews that operates in the mitochondria and it is followed by…
Q: Fill in the table below Monomeric units are called: What are unique monomeric units? Linkages…
A: Nucleic acids are biomolecules that are essential for all life forms. They are polymers of…
Q: Question 5 Listen In cats, Short Hair (S) is dominant to long hair, Black fur (C) is dominant to…
A: The objective of this question is to determine the probability of a specific genetic outcome based…
Q: 6. Malate dehydrogenase catalyzes the following reversible reaction: NAD+ NADH + H* IZI malate…
A: Biological oxidation-reduction reactions or redox reactions involve the transfer of electrons from…
Q: Dihybrid Cross 13 Problem 5: A SsYy x ssyy test cross. Which of the following genotypes would you…
A: The objective of this question is to determine which genotype would not be expected in the offspring…
Q: II. Analysis. Given below is a schematic diagram for a simple analysis of a novel tetrasaccharide…
A: Benedicts test : This is the biochemical test that is used to identify the presence of reducing…
Q: Why is it that the carboxylate "ions" actually partake in the citric acid cycle ratherthan the…
A: The regeneration of oxaloacetate from citrate is called the citric acid cycle. It occurs in the…
Q: 27. The standard-state free energy of hydrolysis for acetyl phosphate in 1,3-Bisphosphoglycerate is…
A: Gibbs free energy charge () is function of standard Gibbs free energy (), temperature (T), universal…
Q: Organic compounds are those substances composed of atoms of a single element. containing chains and…
A: Organic molecules are found in the tissues of animals, plants, bacteria, and fungi; they are also…
Q: 2) You are studying the tripeptide Lys-Val-Thr. a) Draw the full structure of the tripeptide…
A: Pepetides are composed of amino acids. Amino acids are biomolecules where a carbon atom (called…
Analyse and interpret the SCAM data in Fig. 1, and make a table (remember to include a legend) to indicate where each amino acid is located (cytoplasm, membrane, periplasm).
Step by step
Solved in 4 steps with 2 images
- HindII --- 5' GTC - GAC 3', HaeIII --- 5' CC - GG 3', EcoRI --- 5' G - AATTC 3' and BamI --- 5' CCTAG - G 3' 5' AGAATTCTTACGCCGGACGTACCTAGGTTTAGTCGACTC CGCCGCCCCTAGGGTCATCA 3' 3' TCTTAAGAATGCGGCCTGCATGGATCCAAATCAGCTGAGGCGGCGGGGATCCCAGTAGT 5' Number of pieces of DNA , and blunt end fragment (s), and sticky end fragment(s)Three polypeptides, the sequences of which are represented below using the one-letter code for their amino acids, are present in a mixture:1. ATKNRASCLVPKHGALMFWRHKQLVSDPILQKRQHILVCRNAAG2. GPYFGDEPLDVHDEPEEG3. PHLLSAWKGMEGVGKSQSFAALIVILAOf the three, which one would migrate most slowly during chromatography through:(a) an ion-exchange resin, beads coated with positively charged groups?(b) an ion-exchange resin, beads coated with negatively charged groups?(c) a size-exclusion (gel-filtration) column designed to separate small peptides such as these?(d) Which peptide contains the ATP-binding motif shown in the following sequence logo?What is known as Src phosphorylates ZBP1 ?
- Based on the sensitivity of DNA to DNase I, as illustrated in Figure , which type of chicken hemoglobin (embryonic or adult) is likely to be produced in the highest quantity in the following tissues and developmental stages? Q. Brain cells throughout developmentUse the sequence provided here to identify the tag and tag location for the encoded DHFR fusion protein: ATATGCATCACCATCACCATCACATGGTTGGTTCGCTAAACTGCATCGTCGCTGTGTCCCAGAACATGGGCATCGGCAAGAACGGGGACCTGCCCTGGCCACCGCTCAGGAATGAATTCAGATATTTCCAGAGAATGACCACAACCTCTTCAGTAGAAGGTAAACAGAATCTGGTGATTATGGGTAAGAAGACCTGGTTCTCCATTCCTGAGAAGAATCGACCTTTAAAGGGTAGAATTAATTTAGTTCTCAGCAGAGAACTCAAGGAACCTCCACAAGGAGCTCATTTTCTTTCCAGAAGTCTAGATGATGCCTTAAAACTTACTGAACAACCAGAATTAGCAAATAAAGTAGACATGGTCTGGATAGTTGGTGGCAGTTCTGTTTATAAGGAAGCCATGAATCACCCAGGCCATCTTAAACTATTTGTGACAAGGATCATGCAAGACTTTGAAAGTGACACGTTTTTTCCAGAAATTGATTTGGAGAAATATAAACTTCTGCCAGAATACCCAGGTGTTCTCTCTGATGTCCAGGAGGAGAAAGGCATTAAGTACAAATTTGAAGTATATGAGAAGAATGATTAABased on the principles of RP-HPLC, which sub fraction in the figure (P1 to P8) is the most polar? Explain.
- Based on your molecular weight predictions from computational analysis of the DHFR fusion proteins analyzed this semester, what would you estimate the molecular weight of the GST tag used to be?What is the abbreviated name of the human gene that contains the following sequence CATCACGCCTGTCACCACCACCT? 1)APP 2)BCKDHA 3)MLH1 4)XRCC1 5)PMP22 6)ATR 7)MSH2 8)PSEN1 9)KMT2D 10)NF1A scientist discovers a virus encoding a Protein X that degrades a subunit of the elF4F complex. Knowing that this virus transcribes its own mRNAs in the cytoplasm of human cells, why would Protein X be an effective virulence factor?