b. Now do this AGAIN assuming that the DNA and RNA templates are read right to left. DNA strand DNA strand T G MRNA codon CA U tRNA anticodon C A polypeptide TRP
Q: Draw an ouline of the autonomic system and identify the neurotransmitters and receptors such as dopa...
A: INTRODUCTION The Autonomic nervous system is an parr that evolved in the pheriphera ...
Q: You read online that sucrose a carbohydrate can be broken down into glucose when it is in water. You...
A: Introduction: Sucrose is a disaccharide .It consists of two monosaccharide molecules viz fructose an...
Q: What is Denaturation ?
A: Introduction :- Many of the weak connections, or bonds (e.g., hydrogen bonds), inside a protein mole...
Q: 4. What are the possible phenotypes and genotypes of the F1 generation if the P generation consisted...
A:
Q: What is the function of IFT?
A: IFT stands for Inter Ferential Therapy. It was discovered in the early's 1950. It is a very popular ...
Q: True or False: 1. The 6X HIS tag is required for a eukaryotic protein to be expressed in E. coli 2. ...
A: Polyhistidine tag is added to a protein and helps in its purification. A recombinant protein can als...
Q: What are the balanced chemical equations of breathing?
A: Breathing is the movement of air in and out of lungs, that is the organs where gas exchange between ...
Q: What best describes the amoebas division?
A: A single parent is involved in this Mode of asexual account, which is one of the most common types. ...
Q: How do plants use their organs to fulfill essential functions?
A: In plants, different tissue work in coordination to make an organ that completes a particular functi...
Q: Bobby agreed to be hypnotized during a comedy routine. While hypnotized, he stood on his chair and c...
A: Hypnosis is a psychological process. It is a process that involves a therapist having high concentra...
Q: Question # 17 What are living and nonliving reservoirs?
A: Introduction In this question we will discuss about the living and non-living reservoirs.
Q: Could a survivorship curve ever go up from one age interval to the next? Why? Or why not
A: Introduction A survivorship curve is a graph that depicts the number of people in a population who c...
Q: Explain how water molds differ from true fungal molds.
A: Introduction Mold is a fungus that grows in the form of hyphae, which are multicellular threads. Yea...
Q: Example: Three birds loved to eat beetles especially the green (female) and the brown (male). But th...
A: An ecosystem is a natural community of living beings that deals with the external environment and ot...
Q: Forests take in carbon dioxide from the air, thus it is called “carbon dioxide sinks” or “carbon sin...
A: Carbon dioxide sinks are the storage systems which hold most of carbon dioxide in our world These ...
Q: How do you explain evolution to people who believe that it is just a theory
A: Evolution is characterized as the course of development and improvement or the theory that organic l...
Q: Dolphins and fish have similar body shapes. Is this feature more likely a homologous or analogous tr...
A: The organisms are evolved throughout their life. For the identification of evolution in the nature o...
Q: What happens to sister chromatids during anaphase of mitosis?
A: Mitosis is the cell division of somatic cells which results in the production of two identical daugh...
Q: an egg cell were treated with EDTA, a chemical that binds to calcium ions: The acrosomal reaction wo...
A: Physiologically, the acrosomal reaction requires presence of calcium ions for the reaction to happen...
Q: Glomerulonephritis is caused directly by: O a, antibodies and antigens not being filtered out of the...
A: Glomerulonephritis is a renal disease characterized by hypertensive state Oliguria heaematuria Pr...
Q: Explain why a gene drive locus can spread through a population through sexual reproduction.
A: A gene drive is a natural mechanism and genetic engineering technique that propagates a certain set ...
Q: What is reflexive memory?
A: The cerebellum and amygdala are responsible for reflexive memory. In this comparison, aerobic respir...
Q: Why is the Calvin Cycle referred to as the dark reactions, or light-independent reactions?
A: Introduction Calvin Cycle:- The Calvin cycle is part of photosynthesis, The cycle of chemical reacti...
Q: Explain about PCR Applications in in molecular biology ?
A: Introduction: PCR - is Polymerase Chain Reaction carried in vitro or in the laboratory for amplifica...
Q: N-terminus
A: Amino Acid units that make up a protein molecule are joined together in a precise sequence. The chai...
Q: a) In the Dutch population, the results of height on fertility in males is an example of heterozygot...
A: Dutch populations have highest height in entire world.
Q: In three to five sentences, construct an argument that shows why lichens are necessary to establish ...
A: The term lichen was given by Theophrastus. Its symbiotic charecterstic was however stated by Schwand...
Q: Did you find evidence that cellular respiration occurs in plants? Explain using your data
A: Introduction Cellular Respiration:- It is the process or metabolic pathway by which cells in plants ...
Q: Which of the following energy producing pathways in our bodies does NOT require energy? (Choose all ...
A: The term metabolism is associated with biochemical reactions occurring in the cells of the body. Suc...
Q: You are growing E. coli in a laboratory in order to study their operons. The growth media you are us...
A: The prokaryotic gene regulation is known as operon system in which the expression of polycystronic m...
Q: How to identify human genes during library screening ?
A: The term genomic library can be referred to as a collection of DNA clones that, in theory, should co...
Q: Compare the possible differences between a eukaryotic protein-encoding gene cloned by PCR and the sa...
A: Specific mRNAs corresponding to a gene of interest are identified and reverse transcribed to form cD...
Q: Explain the Molecular Techniques for Analyzing DNA ?
A: DNA is a double helical structure that is present in the nucleus of the cell. This DNA contains the ...
Q: A plasmid (a) can be used as a DNA vector (b) is a type of bacteriophage (c) is a type of cDNA (d) i...
A: A plasmid is a circular, single-stranded DNA molecule that differs from a cell's chromosomal DNA.Pla...
Q: What genes are regulated by the a1 and a2 proteins inan a cell?
A: In Eukaryotic cell, gene expression takes place during transcription and RNA processing which is don...
Q: Explain a powerful methodology for studying gene expression ?
A: The functions of a gene can be studied by looking at how it expresses in a specific cell and how it ...
Q: Consider Lamarck’s idea in a hypothetical situation. For example, you decided that when you have chi...
A: Lamarck gave a theory of use and disuse of organs suggesting that those organs will increase in siz...
Q: Explain why slime molds are described as social amoebas
A: Social amoebas are the most exciting structures that is found in nature. They usually have the struc...
Q: New flu strains can arise by______ . a. meiosis c. viral reassortment b. mitosis d. binary fission
A: Introduction:- Influenza The features of the hemagglutinin (H or HA) and neuraminidase (N or NA) sur...
Q: How is the activation of the GAL1 gene prevented in thepresence of galactose and glucose?
A: The process wherein the expression of GAL genes is inhibited in the presence of glucose is known as ...
Q: From the list given - choose all of the regulatory proteins that would bind the eukaryotic gene to c...
A: The transcription is the process that involves production of RNA from the DNA template. In case of e...
Q: Expain the species of soil bacterium ?
A: There are majorly three types of soil bacteria. These bacteria have the ability to fix nitrogen with...
Q: Question # 17 What are living and nonliving reservoirs?
A:
Q: Name the two (2) different varieties of Ginger and describe two (2) characteristics of each
A: * Zingiber officinale belongs to Zingiberaceae family is known as ginger. *Ginger a flowering plan...
Q: Give one similarity and two differences between oxidative phosphorylation and the light reaction of ...
A: * Light reactions of photosynthesis take place on grana of thylakoid. *The thylakoid membrane insid...
Q: Arrange these in chronological sequence of their first appearances on Earth Homo erectus, Lemur, Ch...
A: Evolution is the process of changes in the characteristics of the species from one generation to ano...
Q: ______are members of the phytoplankton . a. Water molds c. Diatoms b. Giant kelps d. Cellular slime ...
A: The phytoplankton is too small to be seen individually with the naked eye. They are autotrophic comp...
Q: In the F2 generation of a homozygous yellow-seed (AA) X homozygous green-seed (aa) cross in peas, tw...
A: The alleles are the alternative forms of a gene that are located on the same locus of a homologous c...
Q: What are the advantages and disadvantages of plate count technique over other methods of quantifying...
A: Plate count is a technique in which bacteria are counted by growing on the agar plates. Total bacter...
Q: 8. Certain types of worms live in the mud at the bottom of lakes. What does the mud represent for th...
A: An ecosystem is a community of different species that interact with one another and their environmen...
Trending now
This is a popular solution!
Step by step
Solved in 2 steps with 1 images
- Illustrate the process of transcription by providing the correct bases for mRNA strand given the DNA template strand. (Remember that mRNA has uracil instead of thymine.) Template Strand: CGATACAAAProtein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"B. Using the DNA sequence above, write a new DNA sequence from 3’ to 5’ that incorporates a transition leading to a silent mutation in the second amino acid. Bold or underline the nucleotide that has been changed
- B Relates to the ribosome codon question please do ii ribosome coding questionsUse your codon chart to determine the amino acid sequence. Remember to read through the strand and ONLY start on AUG and STOP when it tells you to stop. DNA--> CCT CTT TAC ACA CGG AGG GTA CGC TAT TCT ATG ATT ACA CGG TTG CGA TCC ATA ATC mRNA --> protein-->Translate to amino acids the strand using the Genetic Code chart. Remember to use the start and stop sequences. UGCGAUGGCAAUCGGUGUACCCCUGACUGAGC
- Transcribe the DNA sequence from HbA mRNA: nucleotides: ACGTUTranscribe and translate the DNA strand Remember to use the start and stop sequences. ACGGTACCGTTAGCCGACATCGGGGACACTGACTCGIllustrate the process of translation by providing the correct bases for tRNA strand given the mRNA template strand. (Remember that mRNA has uracil instead of thymine.) Template Strand: GCUAUGUUU
- D. Using the DNA sequence above, write a new DNA sequence from 3’ to 5’ that incorporates a transversion leading to a missense mutation in the third amino acid. Bold or underline the nucleotide that has been changed and indicate the new amino acidTranslate the RNA codons using the given genetic code 5' A-U-C-G-A-C-G-A-U-C-C-G-A-U-C-G-A-U 3'DNAT A C C G C T C C G C C G T C G A C A A T A C C A C T mRNA ______ ______ ______ ______ ______ ______ ______ ______ ______ AA ______ ______ ______ ______ ______ ______ ______ ______ ______