Use the 2nd image as guide 2. Roughly sketch the hydropathy plot for the given hypothetical membrane protein. Follow the colorassignments of the helical domains and properly label your plot and axes (NB: Only a rough sketch isbeing asked. No need be exact with the hydropathy indices and residue numbers). Hydropathy Plots10501001502002503↑HydrophobicHydrophilicAminoterminusOutside-31050100150200250Residue numberBacteriorhodopsinInsideCarboxylterminusHydropathy index

The amino acids can be classified based on the polarity of the side chains to form a scale called…

Answered: cch the hyd of the helic

Science

Chemistry

cch the hyd of the helic

Organic Chemistry

9th Edition

ISBN:9781305080485

Author:John E. McMurry

Publisher:John E. McMurry

Chapter26: Biomolecules: Amino Acids, Peptides, And Proteins

Section26.SE: Something Extra

Problem 50AP: The -helical parts of myoglobin and other proteins stop whenever a proline residue is encountered in...

See similar textbooks

Related questions

Q: Ethanol can be created by reacting hydrogen gas, carbon, and oxygen together. Using the following th...

A: The reactions given are,

Q: There are several equations given below. Which equation can be used to find the standard entropy cha...

A: We have given several equations to find standard entropy change (∆S°). We need to tell which one amo...

Q: Current Attempt in Progress What is the correct full range for the values of m, the magnetic quantum...

A: Given-> 3d electron

Q: A student attempts to determine the buffer capacity of a solution by titrating 40.0 mL of solution w...

A: Given: Volume of buffer solution = 40.0 mL = 0.040 L (since 1 L =...

Q: The equilibrium constant, Ke, for the following reaction is 1.20x10-2 at 500K. PCIS(g) PCI3(g) + Cl2...

A: Given -> PCl5---> PCl3 + Cl2. Kc = 1.20 × 10-2 Volume = 15.3 L Moles of PCl5 = 0.359 mole Mole...

Q: Consider the titration of 50.0 mL of 0.501 M weak base B (Kb = 7.5 x 10⁻⁶) with 0.340 M HNO₃. What i...

A: Given, When 50.0 mL of 0.501 M weak base B (Kb = 7.5 x 10⁻⁶) with 0.340 M HNO₃. The pH of the solut...

Q: Balance the following redox reaction in acidic solution. NO(g)+Br,(1) → NO,(aq)+Br (aq) NO(g) + Br, ...

Q: 0 30 5060 70 3600 UALA Weight percent tungsten 90 80 100 3422°C 3400 - 3200 3000 2800 2665 C 2670 C ...

A: Few questions based on phase diagram that are to be accomplished.

Q: Calculate the half-life time & rate constant from the information below , the reaction is 1st order ...

Q: Consider the reaction 2 S(g) + 3 O2(g) → 2 SO3(g). Using the standard enthalpies of formation listed...

A: Here we have to determine the average bond energy of S=O . For this we have to determine enthalpy o...

Q: What is the deltaH for the overall decomposition in this reaction. Please show work NH4CL(s)--> NH3(...

Q: Tell whether if the following changes undergo physical change or chemical change.Write CC or PC. 26....

A: To identify: Physical and chemical changes among the given options.

Q: How much potassium oxalate can be added to 99 mL of 0.35 M [Cu(NH3)4]Cl2 before a precipitate of CuC...

Q: Note: I need a simple explanation for this lesson for my presentation. Thank you!

A: Polymers are composed of many small repeating units (monomer) joined together. Polymers having hig...

Q: From each pair below (attached image), select the molecule that will display stronger intermolecular...

A: The pairs given are,

Q: Draw a structure of a chiral molecule containing Mn atom

A: The structure of a chiral molecule containing Mn atom is :

Q: Problem #1: An electrochemical cell contains Fe3+ and is measured against a Ag/AgCl reference electr...

A: Given : Ecell = 0.703 V Since Ag/AgCl is reference electrode and present in standard condition so ...

Q: Give at least 10 solutions (solid or liquid) and identify the solute and the solvent. SOLUTION SOLUT...

A: 10 examples are given

Q: 6.22 Benzoxazinones form covalent adducts with serine proteases. Suggest a plausible structure for t...

A: Serine OH acts as a nucleophile which attacks on the carbonyl carbon which is followed by ring openi...

Q: please show a step by step mechanism R1 R21 82% yield (Ref: Taylor) (3cis) R1: OCOMe, R2: H (3trans)...

A: Solution: We know when haloforms treated with base (like NaOH) result in formation of carbene. Since...

Q: calculated below. H-F Bond Energy: 567 kJ/mol example H2 (g) + F2 (g) 2HF AHxn = [energy used for br...

Q: Part B 0.90 g of sodium hydroxide (NaOH) pellets are dissolved in water to make 3.5 L of solution. W...

Q: Li o ctly reglux Co,CH3 co, H * Cme : Mdal- SNAC EICB

A: Mechanism involve Formation of aldol followed by E1CB reaction.

Q: A scientist removed a sample of 37.8 grams of a chemical from a container. The sample was 4 1/4 less...

A: Given the mass of the sample removed out of the total mass = 37.8 g Suppose the total mass of the c...

Q: At 0∘C, ice and water are in equilibrium and ΔH = 6.00 KJ mol for the process H2O(S) → H2O(L). What ...

Q: the central atom in each formula, draw the Lewis Structure with all valence electrons shown. N2O ...

A: 1-N2O 2- OCN-

Q: When aqueous solutions of NaBr and AGNO3 are mixed, the reaction produces NaNO3(ag) and AgBr(s). Wha...

A: Correct option is (C)

Q: 2. Calculate AH for the reaction 4NH; (g) + 50, (g) → 4NO (g) + 6H,0 (g), from the following data. 1...

A: Hess's law of heat summation states that when a reaction takes place by more than one step, the enth...

Q: 2. Br HCI, H,O 1. Cl, NaOH, H,0 2. H. H,0 1. P. Br 2. H,0 он 3. CH,NH, 1. LDA EIONA (2 equiv.) 1-bro...

A: o LDA is a bulky base that abstracts proton from the less hindered site o Under haloform reaction co...

Q: HI exсess CHB1,/KOH, i-PrOH Cl2 H, CH;CO;H Lindlar cat. 1. О, 2. (CH3)2S 1. (Sia),BH/THF 2. NaOH, H,...

Q: 9.30 Predict the products of the reaction of phenylacetaldehyde, C6H5CH2CHO, with the following reag...

Q: For substances that will be in thermal contact, how would we know which will absorb energy (heat), a...

A: To determine which substance absorbed heat and which release heat , we would use heat transfer rule,...

Q: the molarity of

Q: (c) Estimate the wavelength of electrons that have been accelerated from rest through a potential di...

A: Given : Potential different by which electron is accelerated = 75 kV = 75000 V

Q: following statements below correctly describes isotopes? a. They are of the same number of neutrons...

A: Atomic number = number of protons Mass number = number of protons + number of neutrons

Q: Devise a 5-step synthesis of the product from the starting material shown. H. 1. reagent 1 2. reagen...

Q: 8+83= %3D Oxygen Carbon %3D

A: Combination reaction: A combination reaction is a type of chemical reaction in which two reactants c...

Q: What quantity in moles of precipitate will be formed when 100.0 mL of 2.00 M NaCl is reacted with 72...

Q: During inhalation, a person's diaphragm and intercostal muscles contract, expanding the chest cavity...

Q: Calculate AS°xn for the following reaction. The S° for each species is shown below the reaction. N2H...

Q: What is the frequency in hertz of blue light having a wavelength of 476 nm? i х 10 Hz

A: In this question, we have to calculate the frequency in hertz of blue light having wavelength of 476...

Q: Show how to carry out the transformation of benzene to chlorobenzene by going through a diazonium in...

A: In this question, we have to carry out the conversion of benzene to chlorobenzene by going through a...

Q: NH3 NH3 CH3CO2H (CO2H)2 H20 NH2OH (CH3CO)20 CH3CO2H

A: Answer of this question :- Firstly, we know what is hydrogen bonding. Hydrogen bonding :- The bond ...

Q: Hypochlorous acid, HOCI(aq), is a weak acid (Ka = 4.0 x 10-8) used in the chlorination of drinking w...

A: a.) To calculate pH , we would draw an ICE table and use its Ka value. b.) Percent ionization is Ca...

Q: D.I.2 Elechophilic Ar omatic fubs ( SEN)[ Comc eptual] CH3 C3 mol) ON ON Reactin i HンS0+ NOL ZON- CH...

Q: What is H3AsO4? H3AsO4 is a White translucent crystal with a boiling point of 120 °C. It is known as...

Q: diene diemphile

A: here we are required to show the mechanism of the Diel's Alder reaction

Q: The solubility product of Mg(OH)2 is 1.2x10-11. Predict whether a precipitate will be formed or not ...

A: The volume of 0.01 M MgCl2 added = 20.0 mL The volume of 1x10-3 M NaOH solution added= 30.0 mL We ha...

Q: A 20.0 mL solution of 0.200M weak acid HA is titrated with a 0.400M NaOH solution. (Ka of HA = 5.0 x...

Q: How many moles of NH3 must be dissolved in water to give 615.4 mL of solution with a pH of 10.96? K ...

A: The number of moles NH3 disolved in water is given below

Question

Use the 2nd image as guide

2. Roughly sketch the hydropathy plot for the given hypothetical membrane protein. Follow the color
assignments of the helical domains and properly label your plot and axes (NB: Only a rough sketch is
being asked. No need be exact with the hydropathy indices and residue numbers).

Hydropathy Plots
10
50
100
150
200
250
3
↑
Hydrophobic
Hydrophilic
Amino
terminus
Outside
-3
10
50
100
150
200
250
Residue number
Bacteriorhodopsin
Inside
Carboxyl
terminus
Hydropathy index

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps with 1 images

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, chemistry and related others by exploring similar questions and additional content below.

Similar questions

The -helical parts of myoglobin and other proteins stop whenever a proline residue is encountered in the chain. Why is proline never present in a protein helix?
A dimeric binding protein has a KD1 of 50 nM and a Hill coefficient of 1.4. What is the fraction of the protein that has ligand bound at 17 nM concentration of ligand?
At what pH is the formationof the acyl-enzyme complex most likely to occur. provide a point. Provide an explanation for this.
The following sequence is part of a globular protein. Predict the secondarystructure in this region. ... RRPVVLMAACLRPVVFITYGDGGTYYHWYH ...
Silica gel is very polar stationary phase. Therefore, more polar molecule sticks to silica gel on the TLC plate and has higherRfvalue. True False
Phosphotungstic acid is one of a number of heteropolyacids. Name additional elements you can bind into heteropolyacids. Why are certain heteropolyacids so important for gravimetric determination of the heteroelement? Briefly describe, draw and discuss at least three of their structures.
Since there are some inherent issues with polarimetric measurements of enantiomeric purity, suggest another technique that could be used to confirm the percent enantiomer excess.
Briefly discuss the significance of hyperconjugation, tautamerism and inductive effect.
what is the Ligand receptor interaction prediction of the structure in the picture that i attached thank you
Consider the partial sequence of a peptide.I L W A N R M S H V L F A V E ASelect all amino acid residues likely to be on the solvent‑exposed surface once the peptide folds into its native conformation.
Asparagine and glutamine residues in proteins are deamidated in an aqueous solution to yield aspartate and glutamate, respectively, and ammonium. Proteins undergoing deamidation of one or more of their Asn or Gln groups have been detected by isoelectric focusing. Why would isoelectric focusing be effective in separating deamidated from non-deamidated protein? Compare the relative pI values of the deamidated and non-deamidated proteins.
show the interaction in the coloured box