give the structure of PNA Sequence and give the 5'-AGCTA-3 Complete Seturaute Structure of Complementry and and Rhes Squence of the DWA sequence abure.
Q: Which of the following are the likely explanations for the failure of a postsynaptic neuron to…
A: The postsynaptic element is often the soma or dendrite of a postsynaptic neuron. The other side of…
Q: 1. Of the three processes - filtration, reabsorption, secretion - which is (are) accomplished by a…
A: Kidney dialysis accomplished all three processes filtration, reabsorption and secretion. The…
Q: Which of the following is true about the pituitary gland The pituitary gland is located beneath the…
A: A) Yes, the pituitary gland is found attached to the hypothalamus, hanging with the help of a stalk…
Q: 50 um Figure 3. Grasshopper testis with differential staining and viewed under a microscope.…
A: Meiosis is a type of reductional cell division consisting of two consecutive stages- Meiosis-I and…
Q: Describe the transcription.
A: DNA is a genetic substance found in all living organisms, from single-celled microbes to…
Q: Define peripheral resistance
A: Introduction The cardiovascular system is also called the circulatory system. It consists of the…
Q: 14C methyl pyruvate is added isolated liver tissue and malonate is used to break succinate…
A: Introduction :- Succinate dehydrogenase (SDH) is a metabolic enzyme complex found in mitochondria…
Q: Answer questions 12-16 , I need the letter of your answer
A: Environment refers to the area where organisms live. Ecosystem is the organised community of living…
Q: Discuss the regulation of the tryptophan operon. How does this story change under the two…
A: Introduction: The trp operon is a collection of genes found in E. coli bacteria that code for…
Q: Describe how the skin and mucous membranes play an integral role in helping the body protect itself…
A: The immune system fights microorganisms and foreign objects on the epidermis, in human tissues, and…
Q: For each level of your species taxonomy explain why it is a part of that section of the hierarchy…
A: The Giant Panda is a bear species found in central and western China's highlands. The Giant Panda is…
Q: A synapse with all of these; a postsynaptic dendrite, an astrocyte end foot, and the presynaptic…
A: Introduction :- Synapses are part of the circuit that connects sensory organs in the peripheral…
Q: - In a paragraph explain a) What is resident flora? b)How might resident flora prevent infection…
A: Healthy people live in harmony with most of the microorganisms that establish themselves on or in…
Q: Discuss the antigen and antibodies relative to 8 blood groups
A: The ABO blood group is represented by substances on the surface of red blood cells. The substances…
Q: How many human proteins are in the range of 250,000 to 900,000 Daltons?
A: The human body is thought to have over a million different types of protein, and even a single-cell…
Q: Assigned Multiple Choice Question Please post the question that you were assigned below During DNA…
A: DNA polymerase III only synthesises DNA in the 5'-3' direction. Ans ) True DNA chain elongation is…
Q: The general requirements for protein transport are signal peptide, receptor, translocase complex and…
A: The Central Dogma theory explains that DNA makes DNA through the process of Replication. DNA makes…
Q: Yoghurt starter culture is a mixed population of S. thermophilus and L. bulgaricus, both competing…
A: The living beings on this planet have been broadly divided into two categories - Plants and Animals.…
Q: When selection favors homozygotes over heterozygotes it is likely that... Incorrect answer - both…
A: Natural selection is a theory that states that organisms evolved by changing their heritable traits…
Q: Define the meaning of nosocomial infection and explain three potential exogenous sources
A: Nosocomial infections are also termed as hostipal-acquired infections. These are those infections…
Q: Which female reproductive structure is equivalent in development to the penis in males
A:
Q: Please explain why Cucumis bloomingtonii is sterile.
A: Sterile The plant or animal which can't produce viable gametes.
Q: A device called a hemocytometer is used to measure the amount of hemoglobin present. Red blood cells…
A: Cancer is a fatal disease that has both physical and mental consequences for a person. Cancer can…
Q: • Name the function of each hormone listed and the structure that produces each of those hormones: o…
A: Hormones are the chemicals that are responsible for controlling and regulating the activities of…
Q: 1. Explain the divisions of the nervous system. 2. Summarize the events involved in the synaptic…
A: Note :- Since you have asked multiple questions im only answering the ist 3 as per bartleby…
Q: What is the antagonist
A: Muscles Muscles are the soft tissue of the body and they help in movement and joining of bones.
Q: Plants
A: Plants are very useful in our daily life. Plants are used to yield fuel, medicines, tools, alcohol,…
Q: What is the specific base sequence found in human telomeres, and how does the base sequence…
A: The physical end of the chromosomal is known as Telomere. It protects the chromosome's ends from DNA…
Q: Histones are proteins that are found to be challenging to investigate and part of an enormous family…
A: Histones/ Histone protein : Histones are a family of basic proteins that associate with DNA in the…
Q: Q 1 Indications of operative dentistry can be seen in all of these except: A-Carious tooth B-…
A: Introduction Operative Dentistry:- It deals with treatment, diagnosis & prognosis of defects of…
Q: In what ways would you expect forced migration to have an impact on the phenotypes of animal…
A: Introduction Migration is that the movement of individuals across entirely different states and…
Q: You made four mutants for a promoter sequence in DNA and studied them for transcription. The results…
A: Promoter are the sequence present in the DNA. These allow the binding of transcription factor and…
Q: why do mangroves prefer to thrive in upper intertidal or optimal level tidal zones than lower…
A: Introduction Mangrove forest- Mangrove trees and shrubs grew in coastal intertidal zones. Mangrove…
Q: Describe the difference between population density and dispersion Why do you think the population…
A: Population density Population dispersion It is a measure of number of individuals of a population…
Q: -Discuss how the presence of glucose impacts the expression of the ara operon.
A: Introduction: The L-arabinose operon, which is called the ara or araBAD operon, for the breakdown of…
Q: Transcription
A: RNA polymerase synthesizes an RNA transcript complementary to the DNA template strand in the 5' to…
Q: 1. What is the active substance and activity/indications (e.g. antibacterial, anti-inflammatory) of…
A: Plants are vital living forms that belong to the Plantae taxonomic kingdom and are further classed…
Q: Do you think it's possible to capture energy from photosynthesis for human use? Use the information…
A: Introduction: Photosynthesis is the process by which plants convert sunlight, moisture, and carbon…
Q: Identify the fixation and embedding protocols of seed tissues for microtome sectioning? How thin…
A: Microtome A microtome is a mechanical instrument which is used to make thin slices of tissues. Thes…
Q: Why is the regulation of body fluids important in living organisms?
A: Introduction Homeostasis is the ability to maintain a relatively stable internal state that persists…
Q: capZ encourages the elongation of actin filaments (true or false) 2)microtubules are tissue…
A: capZ or capping protein involved in assembly and disassembly of actin filaments. capZ cap the…
Q: SBI3C: Case Study-Smoking and Lung Cancer /16 Cancer usually begins in the bronchi or bronchioles.…
A: Answer d Cilia, which are hair-like projections that transport microorganisms and detritus up and…
Q: During meiosis both recombinant and parental type chromatids are created. Which of the outcomes…
A: The meiotic division is characterized by the formation of recombinants. This phenomenon is achieved…
Q: Use Punnett squares in solving the following problems. 1. In garden peas, a plant that is homozygous…
A: A genotype is a group of genes in DNA that are accountable for a specific trait or feature, whereas…
Q: What is the actual meaning of Biocompatible and biodegrable for the scaffolds for biomedical…
A: Introduction A polymer is a natural or manmade substance made up of large molecules termed…
Q: Think about the important functions of telomeres. Now, imagine a scenario in which a mutant…
A: Introduction Telomeres are repeating sequences that protect the natural ends of linear eukaryotic…
Q: 2. Complete the table below for the hormones involved in blood glucose control. Insulin Glucagon…
A: Diabetes is a disease of blood sugar and it is caused by a low level of insulin or nonfunctional…
Q: Draw a diagram that illustrates how these chromosomes pair up during Metaphase I of Meiosis. Be sure…
A: Metaphase I Meiosis is also called reductional division as it results in the production of 4 haploid…
Q: A man has six digits on each hand and foot (an autosomal dominant trait). His wife and first…
A: A condition in which an individual has more than 5 digits is known as polydactyly. Polydactyly is an…
Q: Compare the process of cell division between eukaryotic and prokaryotic cells and list four aspects…
A: Introduction: The distinction between prokaryotes and eukaryotes is widely regarded as the most…
Give a clear handwritten answer with explanation
Step by step
Solved in 2 steps with 1 images
- COMPLEMENTARY DNA SEQUENCE OF GACGGCTTAAGATGCAll 20 of the amino acids coded for by DNA are L configuration. With one exception, theyalso all have S absolute configuration. Which amino acid is the odd one out, having Rabsolute configuration?Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
- you have isolated a new protein called STICKY. you can predict from comparisons with other known proteins that STICKY contains bHLH domain. Predict the function of STICKY and rationale forthe importnce of these domains in sticky function.Exploring the Structure of the 30S Ribosomal Subunit Go to www.pdh.org and bring up PDB file 1GIX, which shows the 30S ribosomal subunit, the three tRNAs, and mRNA. In the box on the right titled ‘Biological Assembly.� click “More Images.� and then scroll down to look at the Interactive Vic By moving your cursor over the image, you can rotate it to view it from any perspective. a. How are the ribosomal proteins represented in the image? b. How is the 16S rRNA portrayed? c. Rotate the image to see how the tRNAs stick out from the structure. Which end of the tRNA is sticking out? d. Where will these ends of the tRNAs lie when the 50S subunit binds to this complex?Glycine is a highly conserved amino acidresidue in proteins (i.e., it is found in the same position in theprimary structure of related proteins). Suggest a reason why thismight occur.
- I was given an amino acid position 564 with the PDC code 2V1X. Would it be possible to describe why this position in the protein is important and outline the effects the mutation will have on the structure / function of the protein? Thank you.GTTTTCACTGGCGAGCGTCATCTTCCTACT 10. Generate a secondary structure prediction for one identified protein.Give the amino acid sequence with some little explanation please. 5′ –GUACUAAGGAGGUUGUAUGGGUUAGGGG ACAUCAUUUUGA–3′
- Provide the DNA sequencce (not RNA sequence) for the Start Codon and 3 Stop Codons.The following sequence is part of a globular protein. Predict the secondarystructure in this region.cRRPVVLMAACLRPVVFITYGDGGTYYHWYH cThe original DNA sequence TACACCTTGGCGACT I need the mRNA sequence and the amino acid sequence And also the mutation type