In 2 paragraphs. Discuss the differences between RNA and DNA, in terms of structure and function. Identify the difference in the nucleobase of RNA from DNA.
Q: Describe the functions of the following proteins during DNA breaks and repair: (i) Ku70 (ii) Uracil…
A: The genetic stability of organisms is important for their survival. Only the presence of accurate…
Q: Structural Stability of DNA True or false Hydrophobic bonding between stacked purine and…
A: Hi! Thank you for posting the question on Bartleby. As per the guidelines we can answer only one…
Q: brown red Jorange
A: Dna is a double helical structure consisting of a deoxyribose sugar, phosphate and nitrogenous…
Q: II. Do what is asked A. 1. a. Use the codon given below to complete the following table. Assume that…
A:
Q: Match the term and its description. Each term can only be used once. a series of nonoverlapping,…
A: A codon is a 3 nucleotide sequence triplet unit and each codon codes for specific amino acids. the…
Q: Use the codon chart to determine the following RNA strand in amino acids (Remember to write it the…
A: Each codon is made up of three nucleotides, each of which corresponds to a single amino acid. The…
Q: Using the central dogma of molecular biology, explain the terms replication, transcription and…
A: The functional unit of heredity is described as the gene that is made up of DNA. A gene is expressed…
Q: Discuss the similarities and differences between RNA polymerase and DNA polymerase
A: A nitrogen base, sugar molecule, and phosphate groups make a nucleotide. Nucleotides are the…
Q: b) Draw a diagram to show how nucleotides are organised in the structure of DNA. Note: You need only…
A: The four most important biomolecules in living things are carbohydrates, amino acids, lipids, and…
Q: Which is NOT a difference between RNA and DNA? A. RNA contains uracil; DNA usually does not.…
A: Deoxyribonucleic acid is a molecule made out of two polynucleotide chains that loop around one…
Q: Illustrate a short DNA segment showing the bonds formed between complementary base pairs as well…
A: Introduction: The two types of nucleic acids are RNA and DNA. The nucleic acid serves as a…
Q: Let’s return to your patient with sickle cell anemia. Below is the RNA sequence from your patient…
A: Sickle cell anemia is a recessive disorder.
Q: Select TRUE or FALSE for each of the following statements: 1. Only one of the three phosphate groups…
A: Human body is composed of different biomolecules that includes nucleic acids (DNA and RNA) proteins,…
Q: Select all of the statements that correctly describe DNA structure: Base pairing will always be…
A: DNA or deoxyribonucleic acid is the molecule that contains the genetic code of organisms. This…
Q: Briefly describe the differences and similarities of RNA and DNA. – Know the difference in their…
A: Introduction DNA:- Deoxyribonucleic acid: It is a long-chain polymer of two polynucleotide chains…
Q: DNA replication involves a
A: DNA Replication: DNA is a self replicating material which carries the genetic information of the…
Q: Describe instances when a DNA mutation would not alter the function of a protein. Describe instances…
A: Genetic material is nothing but the sequence of nucleic acids which is called as DNA. It contains…
Q: plain the steps of translation. Include all molecules involved in the process and their role in the…
A: Every cell has a nucleus that houses genetic material, DNA. Genes are the segments of…
Q: Describe DNA synthesis in detail with the help of diagrams
A: DNA synthesis is DNA replication. It occurs in three stages- initiation, elongation and termination.…
Q: In details summarize the process of Translation and post translation process.
A: Translation: Nucleotide language is transfer to language of amino acids. In short mRNA language is…
Q: Translate this DNA sequence using Genetic Code 5' - ATG GGG cCC GTC CAT CCG TAC GCC GGA ATT ATA - 3'…
A: DNA is transcribed into mRNA through the process of transcription. mRNA is then translated into…
Q: Part I. Answer the following questions in 5 to 7 sentences. 1. What are pentoses? What are the roles…
A: Carbohydrates are also known as hydrates of carbon. They contain elements such as carbon, hydrogen,…
Q: Which choice best fits the blank? Refer to picture. The ribosome moves along the mRNA strand. In…
A: Nucleotide is the basic building block of nucleic acids. RNA and DNA are long chains of nucleotides.…
Q: Can you give further explanations regarding this topic? We are about to tackle this in our next…
A: Our DNA is made up of four bases which are A= Adenine, C= Cytosine, G= Guanine, and T= Thymine. Here…
Q: DNA A G T A C C G G G C A A A C T G C A T T G T G mRNA U C A U G G C C C G U…
A: DNA (deoxyribonucleic acid) was discovered by Friedrich Miescher. Nucleotides are the structural…
Q: Illustrate the process of translation by providing the correct bases for tRNA strand given the mRNA…
A: The genetic code includes the information on DNA for the protein made from RNA, which is called gene…
Q: Complete the table below showing the sequences of DNA, MRNA codons, RNA anticodons and the amino…
A: Note: As per Bartleby Guidelines For Remaining Answers Please Repost The Question. Introduction: A…
Q: Shown below is a DNA coding strand: 5' T-A-C-T-T-C-C-C-G-A-T-C-A-T-T 3' Using the genetic code…
A: The genes in DNA encode protein molecules, which serve as the cell's "workhorses," performing all…
Q: Transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain,…
A: DNA and RNA are nucleic acids present in the organisms. DNA is the deoxy ribose nucleic acid whereas…
Q: How to transfer biological information in protein synthesis? What is the link between DNA and…
A: Central Dogma is a flow of information that is present in the form of nucleotide sequence on the DNA…
Q: Protein synthesis is a complicated process involving DNA being transcribed to RNA, which is then…
A: Protein synthesis is a complicated process involving DNA being transcribed to RNA, which is then…
Q: HN. `NH NH H2N° A. В. Consider the 3 structures shown. Which of these is (normally) NOT present in…
A: Nucleic acids are the major class of biomolecules that are important for all forms of the organism.…
Q: True or false Both pentose nucleic acid and deoxypentose nucleic acid contain the same pyrimidines…
A: Disclaimer: Since you have posted a question with multiple sub-parts, we will solve first three…
Q: PART C. Use your codon chart to determine the amino acid sequence. Remember to read through the…
A: the three-letter genetic code is the way by which the cell transcript the information from DNA to…
Q: Define the primary structure of DNA/RNA. Compare and contrast to the primary structure of proteins.
A: DNA/RNA are basically called as nucleic acid and it is important class of macromolecules which is…
Q: d. In the given segment, illustrate and indicate the direction of synthesis of: 1. a 5-nucleotide…
A: we are answering D part E part is missing pls repost for E part.
Q: Jse the table below to help you answer the following questions. THE CODON TABLE FIRST POSITION…
A: Given: DNA: TAC-GCT-ATG-AGC PROTEIN: METHIONINE-ARGININE-TYROSINE-SERINE. MUTATION DNA:…
Q: Mention and explain 4 characteristics of the Structure of DNA.
A: DNA- Deoxyribose Nucleic Acid
Q: onstruct and explanation based on evidence of how the structure of DNA determines the structure of…
A: According to the central dogma of molecular theory, the information stored in the DNA is first…
Q: Let’s return to your patient with sickle cell anemia. Below is the RNA sequence from your patient…
A: The mutations can change the amino acids coded as the codon changes. The mutations can be silent…
Q: рyrim 1. Distinguish between a purine, pyrimidine, hucleoside, nucleotide, polynucleotide, and…
A: INTRODUCTION DNA and RNA are the nucleic acids found in all organisms responsible for the…
Q: Compare the different hydrolytic products of RNA and DNA
A: DNA and RNA are two types of nucleic acids. The major difference between DNA and RNA is the absence…
Q: Order of bases in DNA Order of bases in MRNA Order of basea in tRNA (anticodon) Amino acid coded…
A: DNA molecules are the carriers of genetic information in nucleus of a cell. The DNA undergoes the…
Q: Illustrate the process of transcription by providing the correct bases for mRNA strand given the DNA…
A: Transcription is the process where the genetic information on the DNA strand is transferred into an…
Q: DNA strand below: 3’ T A C A T G C C G A A T G C C 5’ Discuss how will replication happen by…
A: Introduction: DNA stands for 'deoxyribonucleic acid' and it is the hereditary material in humans and…
Q: Name 3 differences between RNA and DNA.
A: DNA(deoxyribonucleic acid) and RNA (ribonucleic acid) are types of nucleic acids that make up the…
Q: List 4 possible differences between DNA and RNA
A: DNA that is deoxyribonucleic acid and RNA (ribonucleic acid) are polynucleotide structures, which is…
Q: Different types of mutations and how to use the genetic code table.
A: Mutations are described as the changes that occurs in the sequence of DNA. Mutations can occur from…
In 2 paragraphs. Discuss the differences between RNA and DNA, in terms of structure and function. Identify the difference in the nucleobase of RNA from DNA.
Step by step
Solved in 2 steps
- Describe the structure of an RNA nucleotide while pointing out the various differences between RNA and DNA (structural and functional differences).Name 2 differences in the structural features of DNA and RNA and indicate the relevance of each difference to the function/s of DNA and RNA. Number your answers.Illustrate the process of transcription by providing the correct bases for mRNA strand given the DNA template strand. (Remember that mRNA has uracil instead of thymine.) Template Strand: CGATACAAA
- VISUALIZE Sketch a pyrimidine nucleotide subunit that would be found only in RNA. Circle and label the three components that make up this type of nucleotide. Explain what changes in the functional groups of this subunit would have to occur for it to be found in a DNA molecule.Illustrate the process of translation by providing the correct bases for tRNA strand given the mRNA template strand. (Remember that mRNA has uracil instead of thymine.) Template Strand: GCUAUGUUUWhich choice best fits the blank? Refer to picture. The ribosome moves along the mRNA strand. In panels b, c, and d, new tRNAs carrying ___________. match up with the codons of the mRNA strand. After each tRNA locks into place, a peptide bond forms between the amino acid the tRNA is carrying and the amino acid already there. This process repeats until the end of the sequence is reached. A. ProteinsB. NucleotidesC. Amino Acids
- Let’s return to your patient with sickle cell anemia. Below is the RNA sequence from your patient and from her mother. (The ••• represents another 30 nucleotides not written out here). The affected nucleotide is indicated in BOLD. Patient’s RNA: 5’ –CUAUGACAGAGUUC•••CAUUAGCCA – 3’ Mother’s RNA: 5’ –CUAUGACAGUGUUC•••CAUUAGCCA – 3’ A) Write out the first 10 nucleotides corresponding to the DNA sequence of the coding strand for your patient in the 5' to 3' direction. B) From the information you have been given, why is it not possible to accurately write out the DNA sequence as it would really be found in the genome? (ie, what you wrote down in part A is NOT necessarily what the DNA sequence would really look like if we could examine the chromosome directly - why? And no this has nothing to do with the 30 nucleotides that aren’t written out or the mutated base). Your answer should be 1-2 sentences maximum.Please ASAP. Thank you. Regarding the double helix of DNA, which of the following is true? a. Guanine pairs up with cytosine with three hydrogen bonds b. Complementary strands of DNA are held together by covalent bonds c. The backbone consists of ribose sugars H-bonded to phosphate groups d. Uracil pairs up with adenine with two hydrogen bondsIn one paragraph, using your own words, describe the structure of DNA. Be sure to include the following terms: nucleotide, phosphate, adenine, cytosine, guanine, and thymine.
- Picture is only attached as reference. However there are some words in the questions that may be understood by looking at the picture. Thanks!- Describe the base-pair rule.- What three things make up a nucleotide?- What does anti-parallel mean?Mention and explain 4 characteristics of the Structure of DNA.Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"