Match the region A,B,C. Question 4 Below is the structure of a hypothetical photo-affinity probe analogue of the anti- malarial drug artemisinin: C H H. H HN artemisinin photoaffinity probe Match the regions A, B, and C as indicated in the structure with their role in the photoaffinity labeling experiment Cross-links with nearby proteins in the presence of UV light [ Choose ] Allows for identifying/isolating ("fishing") the protein-probe adduct out of a complex mixture [ Choose ] Non-covalently binds to the same [ Choose ] protein target as artemisinin would have

Match the region A,B,C. Question 4 Below is the structure of a hypothetical photo-affinity probe analogue of the anti- malarial drug artemisinin: C H H. H HN artemisinin photoaffinity probe Match the regions A, B, and C as indicated in the structure with their role in the photoaffinity labeling experiment Cross-links with nearby proteins in the presence of UV light [ Choose ] Allows for identifying/isolating ("fishing") the protein-probe adduct out of a complex mixture [ Choose ] Non-covalently binds to the same [ Choose ] protein target as artemisinin would have

Organic Chemistry

8th Edition

ISBN:9781305580350

Author:William H. Brown, Brent L. Iverson, Eric Anslyn, Christopher S. Foote

Publisher:William H. Brown, Brent L. Iverson, Eric Anslyn, Christopher S. Foote

Chapter3: Stereoisomerism And Chirality

Section3.8: The Significance Of Chirality In The Biological World

Problem BQ

See similar textbooks

Similar questions

If your molecule C4H11N5 was the side chain of an amino acid, in a protein, what tertitary structure stabilizers could be present? Make a key and use colors to highlight what part of your structure can be stabilized in each manner?
The following sequence is part of a globular protein. Predict the secondarystructure in this region. ... RRPVVLMAACLRPVVFITYGDGGTYYHWYH ...
A 1.00-mg sample of a pure protein yielded on hydrolysis 0.0165 mg of leucine and 0.0248 mg of isoleucine. What is the minimum possible molar mass of the protein? (MMleucine=MMisoleucine=131g/mol)
For alanine, Ka1=5.1105,Ka2=1.81010 . Calculate the ratios [Z]/[C+] and [Z]/[A+] at pH (a) 2.00. (b) 6.00. (c) 10.50. What is the principal species at each pH?
How many of the -amino acids shown in Table 26-1 contain aromatic rings? How many contain sulfur? How many contain alcohols? How many contain hydrocarbon side chains?
Hemoglobin has pI=6.8. Does hemoglobin have a net negative charge or net positive charge at pH=5.3? At pH=7.3?
Refer to the bar graph below, Explain why the n→π* interactions contributes more to the overall stabilization of the protein than all the other interactions(C-H-O hydrogen bond,π-π interactions, C5 Hydrogen Bonds, Cation-π interactions, Sulfur-arene interactions, Anion-π interactions, Chalcogen bonds, X-H-π interactions) even though n→π* is the weaker interaction. Explain why that's the case for EACH of the bonds. I.e Why n→π* interactions contribute more to the overall stabilization of the protein than C-H-O hydrogen bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than π-π interactions even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than C5 Hydrogen Bonds, even though n→π* is the weaker interaction. Why n→π* interactions contribute more to the overall stabilization of the protein than Cation-π interactions, even though…
Indicate (no more than 2) for the following compound:HomotopicHeterotopicEnantiotopicDiastereotopic
Using alanine as an example, draw possible conformations of alanine in a peptide chain (Ala-Met-Thr) and identify which conformer is favoured.
Can facial and meridional isomers be chiral? justify
a 3d structure of protein with acces number of P02008 at uniprot database.
In 0.1M solution glycine (pKa 9.6) at pH of 9.0, what fraction of glycine has its amino group in the -NH3+ form?