Q: Elucidate the process how to diagnose starvation related problems in an aquaculture operation
A: Starvation is a process that begins after a meal is digested and extends until food is again…
Q: The 32 year-old woman is 20 weeks pregnant and is admitted for treatment of esophageal candidiasis…
A: The clinical alteration system is a classification system for diagnosing used by medical…
Q: To summarize: The effects of solar energy on the Earth's temperature.
A: Solar energy is crucial for creation of green house effect. Green house effect trap heat under…
Q: The point value of problems is given in braci number utilizes the enzyme a. Anticodon b. Polymerase…
A: Answers :- 1)RNA is synthesized on a DNA template in a process called transcription , which utilizes…
Q: Biology Discuss the sequencing methods of the human genome used in 2000- the strength and…
A: The genome is a collection of biological instructions that are passed down from generation to…
Q: Describe five ways in detail, which you can reduce your ecological footprint to save our planet…
A: Ecological footprint : The ecological footprint shows how much of an impact can an organism or a…
Q: Name and briefly describe the two phyla of seedless vascular plants.
A: Vascular plants (tracheophytes) Include specialised supporting & water-conducting tissue termed…
Q: Name the organism in this picture . What does it use for locomotion? Eukaryote or prokaryote? What…
A: Isotricha species- In the given slide/picture Isotricha species are holotrich protozoa. This means…
Q: The birthrate of USA is 12 per 1,000 per year and the death rate is 9 per 1,000 per year. What is…
A: Annual growth rate = birth rate - death rate = 12 - 9 = 3 per…
Q: Explain the concept of Co-evolution.
A: Introduction Evolution can be defined as the change which occurs as the heritable characteristics of…
Q: Using the genetic code, indicate which polypeptides would be synthesized if poly-UGG were used in a…
A: Polypeptides are amino acid chains that forms the various protein molecues in our body. These…
Q: 1. Which of the following PAMPS do scavenger receptors mainly recognize? a. Flagellin O b.…
A: 1. a.. Flagellin. PAMPs mainly recognise Pattern recognition receptors (PRRs), which is a protein.…
Q: Which of the following is a role of CLRS in host recognition? O a. Direct cell killing O b. Cell to…
A: C Type Lectin Receptors The CLRs or the C type Lectin Receptors are pathogen recognition receptors…
Q: All early hominids from Africa older than 2 million years (pre-genus Homo) possessed small brains,…
A: Answer--- True
Q: f all the Petri dishes/agar plates grew bacteria, including the control, what do you think could be…
A: Bacteria: Bacteria are single-celled organisms that are tiny. Bacteria can be found practically…
Q: Which type of cell? Relative % normally
A: In the body of healthy person, lymphocytes make up about 25 to 30 % of the total leukocytes. These…
Q: Place the steps for calculating predicted genotype frequencies in order from first to last. 1.…
A: Introduction In the absence of other evolutionary factors, the Hardy–Weinberg principle, also known…
Q: Which type of cell? Relative % normally?
A: The cell displays the following attributes - 1. Granule-like contents 2. Multi-lobed nucleus (3…
Q: What are the economically important members of the Musaceae family? Give its characteristics and…
A: Musaceae is a group of Flowering plants made out of three genera with around 91 known species,…
Q: Would you still need telomeres and telomerase to complete eukaryotic chromosome replication if…
A: Both eukaryotes and prokaryotes have chromosomes that contain their DNA. Prokaryotic chromosomes are…
Q: Discuss how imbalanced dietary amino acids could lead to diseases in fish.
A: Essential amino acids are a major part of diet in fishes for their optimum health. Various problems…
Q: -What are the governmental regulations, international standards, or product recommendations of a…
A: Pacemakers are devices that generate electrical activity, which is utilized to treat patients having…
Q: Do you believe that aquaculture has a promising future in the Philippines after learning its…
A: The Philippines now contributes only a little over one percent of global farmed fish production…
Q: List the fish diseases associated with oxidized dietary lipids
A: Lipids high in polyunsaturated fatty acids (PUFA, especially EFA) are highly susceptible to…
Q: Detailed measurements of sarcomere length andtension during isometric contraction in striated…
A: The muscle fiber functional unit is known as a sarcomere. It is basically a distance between two…
Q: In a cross of two pure-breeding lines of tomatoes producing different fruit sizes; the variance in…
A: Genes, environment, and gene interactions are the three main contributors to phenotypic variation…
Q: Which type of cell? Relative % normally?
A: These are leukocytes or white blood cells. Largest type of leukocyte it is.
Q: The process that occurs when these hydrogen atoms (along with electrons) pass back to the stroma…
A: The light-dependent reaction includes absorption and conversion of light energy into the energy-rich…
Q: Biology help plz??? urgent 1. Which of the failiowing is a location where scavenger receptors are…
A: 1. b cell surface - they mainly found on myeloid cells and other cells 2. C extracellular sugars…
Q: Discuss completely the functions of the connective tissue of the dermis.
A: The dermis, positioned between the epidermis and subcutaneous tissues, also known as the subcutis…
Q: To explain: The effect on nitrogen cycle if all bacteria were absent.
A: The continuous cyclic biogeochemical pathway through which circulation of nitrogen occurs among all…
Q: Which of the following changes would cause directional selection? a A habitat made of trees with…
A: Directional selection This selection takes place when organisms having characteristics represented…
Q: -Please draw a FAST diagram of a pacemaker.
A: A small device that helps to control abnormal heart rhythms is called a pacemaker which is placed in…
Q: Explain the process how to diagnose starvation related problems in an aquaculture operation
A: Aquaculture is the breeding, raising, and harvesting fish, shellfish, and the aquatic plants. It is…
Q: Using ClustalOmega (available here), compare the nucleotide sequence of the regulatory region for…
A: Introduction A mutation is a change in an organism's DNA sequence. Mutations can be caused by errors…
Q: To explain: The way in which a food web change if all decomposers were eliminated from it.
A: The sun provides energy to the planet in the form of light. The organisms efficiently exploit the…
Q: To explain: The reason why the given pyramid of biomass is inverted.
A: The sun sends light to the Earth. The energy supply is efficiently utilised by the organisms for…
Q: How to calculate dilutions in standard plate count? What is the microscopic counting chamber? How…
A: Serial dilutions are used to calculate the concentration of microorganisms.
Q: The portion in the TRNA that is complementary with the MRNA when the aminoacyl-tRNA reaches the A…
A: An anticodon is a trinucleotide sequence located at one end of a t RNA molecule, which is…
Q: Question 12 Which of the following best describes the assembly process to initiate translation in…
A: Introduction Translation is the process by which ribosomes in the cytoplasm or endoplasmic reticulum…
Q: 1. Which of the folowing is a location where scavenger receptors are expressed? a. Nucleus O b. Cell…
A: Note: As Per Guidelines, We Can Answer One Question At A Time. Ask Again To get rest answers.…
Q: Could the RNA polymerase used for transcription be used as the polymerase that makes the RNA primer…
A: RNA polymerase is a multi-unit enzyme that uses the transcription process to create RNA molecules…
Q: Describe the life cycle of ferns and compare their sporophyte and gametophyte generations.
A: Ferns are vascular plants with leaves. While they, like conifers and flowering plants, have veins…
Q: Homo Habilis had relatively short legs. This suggests that it retained a primitive form of…
A: Fact Homo habilis, or "handy man," was one of the earliest known humans, living between 2.4 million…
Q: Use the measurement tool to measure the zone of inhibition for each antibiotic sample in millimeters…
A: Antibiotic zone of inhibition Antibiotics are the compounds or substances that kill or inhibit the…
Q: How does our ability to model global primary production compare to atmospheric measurements of CO2?…
A: The primary source of carbond ioxide released to the atmosphere by human activities derives from…
Q: The ability to taste the compound PTC is controlled by a dominant allele T, while individuals…
A: Hardy-Weinberg equation is important to study the population genetics of a particular species. This…
Q: Biology Classify the vertebrate groups (amphibians, reptiles, birds, and mammals) in terms of…
A: Cladistics classification of vertebrates :-
Q: The possible existence of E.H.1 (extinct hominin 1) was a concept introduced in class lectuer. This…
A: Apes evolved alongside hominids, although they are not hominid ancestors. The progenitors of both…
Q: What are some examples of the interactions between biotic and abiotic factors in a freshwater…
A: In a fresh water ecosystem the biotic and abiotic factors interact in order to provide nutrients to…
![e. MRNA
3. [1] Proteins contain
different amino acids, whereas RNA is composed of
different nucleotides:
a. 20, 64
b. 3, 20,
C. 4, 20
d. 20, 4
ính of the following is NOT](/v2/_next/image?url=https%3A%2F%2Fcontent.bartleby.com%2Fqna-images%2Fquestion%2Ff1a2429b-9cad-4411-882c-bbfe07eef8f6%2Fb5c08ced-d520-45e1-841c-164adf493a6a%2F7jwfcu9_processed.jpeg&w=3840&q=75)
Step by step
Solved in 2 steps
- Protein folding a. is essential to make a functional protein and occurs spontaneously b. is mediated by peptide bonds and hydrogen bonnds c. is a random process essential for the 3D shape of the protein d. is essential to make a functional protein and occurs with the help of chaperonesDescribe the relationship between the tRNA and mRNA describedThe information in mRNA is in a tandem array of , each of which is three nucleotides long.
- Explain RNA's structure and rolesProtein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
- 9) A hypothetical protein is 250 amino acids long how many nucleotides are in the code and sequence of the mRNA? A) 1000 B) 500 C) 1 million nucleotides D) 750 E) 1400Proteins play many different and important roles in the body. Explain how all of the types of proteins within the body are similar and how they are different. Then, describe if all cells are able to code for proteins.Give the protein synthesized of the given mRNA sequence. No need to explain. Just give the answer. ACUGAAAUGACCAGAUUUAUGGCCUGAAUGACC
- C. Sequence the following steps in protein synthesis from first to last (1-6)___A. Transciptions___B. tRNA - amino acid unite link to mRNA___C. Amino acid separate from tRNA ___D. Polypeptide chain assembled ___E. mRNA links to ribosome___F. Stop codon encountered in mRNAwhich statement about genetic code is not true? A) mRNA is read 3 bases at a time, which are called codons. B) There is one initiator codon that codes for an amino acid. C) Each amino acid is coded for by only one codon. D) There are 3 termination codons that do not code for amino acids. E) Each codon is specific for only one amino acid. An anion has an equilibrium potential of -40 mV. What direction are the chemical and electrical forces acting on the anion at the resting membrane potential (-70 mV)? A) Both the chemical and electrical forces are directed out of the cell. B) The chemical force is directed out of the cell and the electrical force is directed into the cell. C) The chemical force is directed into the cell and the electrical force is directed out of the cell. D) There is insufficient information to answer this question. E) Both the chemical and electrical forces are directed into the cell.A protein has the sequence of amino acids shown below. Construct a mRNA molecule that could code for this protein: Phe Ala Met Ser Thr Leu Val