eir è. Amino acid 39.Which of the following is not true regarding RNA? a. RNA is single stranded b. RNA contains uracil instead of thymine c. RNA nucleotides contain one deoxyribose sugar d. RNA nucleotides contain one ribose sugar e. RNA is made by transcribing DNA UITTTIcrograph shows a). ©Jeremy Burgess/SPL/Science Source; (b): ©
Q: 3. Use the 15 molecules illustrated below to answer the following question. Nucleotides consist of a…
A: The basic structure of nucleotides is shown below:
Q: IV. Oswald Avery, McCarty and McLeod (Early 1940s) After Griffith's experiment most scientists…
A: Genetic material is nothing but the sequence of nucleic acids which is called as DNA. It contains…
Q: Could you please write a brief explanation about "Protein Evolution - Primary Structures of Proteins…
A: Proteins are unbranched polymers constructed from 22 standard α-amino acids. They have four levels…
Q: et’s return to your patient with sickle cell anemia. Below is the RNA sequence from your patient…
A: Sickle cell disease causes often term that they are usually state as chronic hemolytic anaemia,…
Q: 1) Complete the following tables by filling in the DNA sequence, MRNA codons, and the amino acids…
A: The genetic material DNA is converted into RNA and this mRNA codes for a specific protein which is…
Q: Name X and state how it functions in a protein synthesis. e) Give three differences between…
A: There are two strands which are anti parallel to each other which means they have opposite polarity,…
Q: The nucleic acid bases: A)absorb ultraviolet (260 nm) light. B)have all of these described…
A: Introduction: Nucleic acids are one of the major macromolecules present mainly in the nucleus of the…
Q: Consider a template strand of DNA with the following sequence: 3 '–CAA TGT ATT TTT GCT–5 '. (a) What…
A: Gene expression is the process by which the instructions in our DNA are converted into a functional…
Q: 4. Indicate whether each of the following words orphrases applies to proteins, DNA, or both.a. a…
A: Deoxyribonucleic acid (DNA) is the genetic material of most organisms that contains coded genetic…
Q: 0. The process used to join two molecules of nucleic acid together (or any two organic molecules,…
A: Two simple substances are called monomers.
Q: A BIOL 1000 student is provided with the primary structure of a protein and told to predict the…
A: Yes, the students were correct. DNA →RNA(have codon) →Protein The genetic code is a set of rules…
Q: Some events that take place in proteins synthesis are shown below: A. peptide bonds are formed B. a…
A: Protein synthesis involves transcription and translation. Transcription involves three steps…
Q: How is a protein made in the cell? * O One strand of DNA in the ribosome combines with amino acids.…
A: Translation is the process of formation of a sequence of amino acids using messenger RNA as a…
Q: List 3 similarities and 3 differences between DNA and RNA moleculesWhen answering this question list…
A: DNA(deoxyribonucleic acid) and RNA (Ribonucleic acid) are the two type of nucleic acids found in…
Q: THCA 100 This reaction is Entropy is THC ( Leafly Mur AD RNA polymerase ATGACGOATCAGCCOCAAG…
A: Tetrahydrocannabinol Acid when heated converts into delta-9-tetrahydrocannabinol. the reaction is…
Q: At least three types of RNA are required for protein synthesis. Compare and contrast mRNA, rRNA, and…
A: RNA or ribonucleic acids are significant components used in expression of genes via protein…
Q: 2. A protein has the amino acid sequence DSRLSKTMYSIEAPAKLDWEQNMAL How many peptide fragments would…
A: The proteases are responsible for the breakdown of protein into smaller fragments. Examples of…
Q: 31. AN ENZYME WHICH IS A LOW MOLECULAR WEIGHT AND DIALYZABLE? A. APOENZYME B. HOLOENZYME C.…
A: “Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: AKS 5ct: Use the chart below to answer the question that follows. Which of the models below…
A: Deoxyribonucleic acid (DNA) is a genetic material and it carries genetic information from one cell…
Q: Define the following terms:a. protein motifb. conjugated proteinc. dyneind. zwitterione.…
A: Introduction: Proteins are major biomolecules that consist of long chains of amino acids. The…
Q: Which of the following is not true with respect to RNA? a). A single-stranded chain of…
A: DNA and RNA are nucleic acids present in the organisms. DNA is the deoxy ribose nucleic acid whereas…
Q: Below is a polinucleotide sequence of the non-template strand of a coding DNA sequence. Use the info…
A: Central dogma of molecular biology: It states that the DNA which contains the genes are…
Q: Assume the first nucleotide in the sequence is at the +1 position. Transcribe the DNA sequence into…
A: Deoxyribonucleic acid is the genetic material found within a cell's nucleus. Before cell division,…
Q: nitrogenous bases, what are the hand rails or backbone of the ladder made up of? A. Sugar B.…
A: 2. They showed that alternating deoxyribose and phosphate molecules form the twisted uprights of the…
Q: When a protein is denatured using heat Select one: a. its C-terminal will change. b. its tertiary…
A: Proteins are amino acid chains that are primarily joined by peptide bonds. However, these primary…
Q: 2a. The DNA is mutated on the 4th base pair to the following: DNA:3'TAC GAT GAG GTC 5' АTG CТА СТС…
A: No, this mutation might not change the way in which the protein functions. In this mutation the…
Q: nucleotide sequence has providen to you, you have only the name of source organism. - how will you…
A: For finding the nucleotide sequence for proteins first Use the NCBI BLAST service to perform a…
Q: 3. Label the illustration below using the following terms: DNA, MRNA, codon, transcrip translation,…
A: All the living organisms contain genetic material. The genetic material is responsible for passing…
Q: An alpha helix of a protein has the sequence FFVGNDHMVEDVERFIREFPDA. One researcher studying this…
A: Protein refers to the biomolecule formed by the association of amino acids. They are also called…
Q: Which of the following statements regarding RNA is false? O A) RNA is a nucleic acid. O B) One RNA…
A: RNA stands for Ribonucleic acid. It is one of the genetic material present in the cell. The whole…
Q: The four nitrogen bases in RNA are adenine, _______, _______, and _______. Select all that apply.…
A: Introduction :- Ribonucleic acid is a nucleic acid that has structural similarities to DNA and is…
Q: Even when a gene is available and its sequence of nucleotides is known, chemical studies of the…
A: Proteins are polymers of amino acids which is translated from the mRNA. Gene (DNA) is transcribed…
Q: 3. 3' CTT TCT TGT AGT TẠC CGG GTA GAA TAG TTG CTG ACT 5'
A: DNA is the genetic material of most living organisms. The DNA is inherited from the parents and it…
Q: Transcribe the following DNA strand into mRNA and translate that strand into a polypeptide chain,…
A: Transcription is the process by which RNA is synthesized from DNA. The genetic material is…
Q: DNA and RNA are both information carrying molecules that are essential to all forms of life today.…
A: Nucleic acids The two main types of nucleic acids are DNA and RNA. Both DNA and RNA are made from…
Q: A. For each of the following nucleotide sequences, determine the amino acid sequence. 1. 5'…
A: Introduction Amino acids are molecules that combine to form proteins, They build muscles, prevents…
Q: 2. The rising of nanotechnology paved way to discover new trends, one of which is the discovery of…
A: The proteins are formed when ribosomes read an mRNA. The base triplets or codons on the mRNA are…
Q: onstruct and explanation based on evidence of how the structure of DNA determines the structure of…
A: According to the central dogma of molecular theory, the information stored in the DNA is first…
Q: Explain how DNA serves as the genetic material of an organism and how it can be used to create RNA…
A: Answer: DNA (DEOXYNUCLEOTIDE ACID) = This the chain of nucleotides having sugar and phosphate…
Q: Select all of the true statements regarding the molecule below: NH, 12 N: -NH G -NH2 ОН H,N ОН 'NH…
A: RNA is a genetic material of most of the viruses .It is either present in single stranded or in…
Q: The following statements best describe the RNA structure EXCEPT A) the repeating units are…
A: S.No. DNA RNA 1 Deoxyribonucleic Acid. Ribonucleic Acid. 2 Generally double…
Q: Boris Magasanik collected data on the amounts of the bases of RNA isolated from a number of sources,…
A: RNA (ribonucleic acid) is a ribonucleotide polymer found in living organisms. Each ribonucleotide…
Q: The sequence of nucleotides found in mRNA is determined by the a) structure of DNA polymerase, b)…
A: The flow of information in the cell takes place from the DNA to the proteins. Proteins once…
Q: A protein that has been reversibly denatured has Multiple Choice temporarily lost part or all of its…
A: Answer :- Option (C) is correct. - Temporarily lost part or all of its secondary and tertiary…
Q: 1. A DNA fragment was sequenced; however, the scatter-brained professor lost track of the direction…
A: In a transcription unit; the there are 2 DNA strands. The strand with polarity 3' to 5' is the…
Q: In a DNA molecule, a sugar, phosphate, and nitrogenous base are collectivley referred to as A. DNA…
A: Nucleic acid is a long chainlike molecule composed of nucleotides found in cells of all living…
Q: e coded information in a DNA molecule directly determines the formation of ____________. * a.…
A: Since you have posted a question with multi- sub parts , we will solve first three sub-parts for…
Q: Given the following DNA strand: TACAGAGATAACCGAATT A. Write the corresponding strand that would…
A: Introduction Deoxyribonucleic acid, or DNA, is a molecule that holds the instructions that allow an…
Q: Given the following DNA strand: TACAGTGATAACCAGATT A. Write the corresponding strand that would form…
A: A) the corresponding strand that would form the other half of the DNA molecule is ATGTCACTATTGGTCTAA…
Trending now
This is a popular solution!
Step by step
Solved in 4 steps
- Modified TRUE or FALSE. Write the word TRUE if the statement is correct. If the statement is false, write the incorrect underlined word/s and indicate the correct word/s to make the statement true. Extreme temperatures and pH can cause permanent disruption of the protein primary structure(s) of enzymes that leads to loss of active site shape, loss of binding efficiency and activity.The precise biochemical activity of a protein is described ina) Phenotypic functionb) Cellular functionc) Molecular functiond) Structural genomicsUpload a drawing of Gly-Met-Asn-Glu-His Label the alpha carbons Label the R groups as hydrophobic or hydrophilic Label the acidic and basic R-groups Label the peptide bonds Label the N terminus and the C terminus
- Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"PLEASE ANSWER WHY? Some substitution mutation result in a malfunctioning protein but others do not. Why is this? DNA and RNA contain______ types of nitrogenated bases each. Three of them: A, G, and C, are the same for both. However, only DNA has________ and the only RNA has______ . The pairing of the bases is very specific, with G pairing with______ only. in DNA, the pairing is______, and in RNA it is_____ . The pairing of bases is due to______ bonds between them. *Please use answer key options attached in the image below. Thank you.
- After viewing https://www.youtube.com/watch?v=qIwrhUrvX-k , relate the structure of the three RNA to their function in building of Polypeptide and point out the characteristics of a genetic code and their function in translation. 1. Messenger RNA 2. Transfer RNA 3. Ribosomal RNA31. AN ENZYME WHICH IS A LOW MOLECULAR WEIGHT AND DIALYZABLE? A. APOENZYME B. HOLOENZYME C. PROENZYME D. COENZYME 32. USING THE GENETIC CODE, WHICH OF THE FOLLOWING IS NOT A TERMINATION CODON? A. UGA B. AUG C. UAA D. UAG 33. WHAT IS THE INITIATION CODON ON THE GENETIC CODE? A. UAA B. AUG C. UAG D. UGA 34. HOW MANY AMINO ACIDS ARE THERE IN THE PEPTIDE SEQUENCE CORRESPONDING TO AGGGCAUGCACCCGAGCUAAUGG? A. 8 B. 4 C. 10 D. 14 35. CONSIDERED THE BUILDING BLOCKS OF NUCLEIC ACID? A. SACCHARIDES B. NUCLEOTIDES C. AMINO ACIDS D. FATTY ACIDBIOLOGY ACTIVITY -Gene Mutations and Proteins Objective: To demonstrate how gene mutations affect the production of proteins? Procedure: Use the following base sequence of one strand of an imaginary DNA molecule: AATTGAACACATGCGCCC. 2. Write the base sequence for an mRNA strand that would be transcribed from the given DNA sequence. Place your results in the table below. Use your codon table provided below to determine the sequence of amino acids in the resulting protein fragment. Place your results in the table below. If the fifth base in the original DNA strand were changed from G to C, how would this affect the resulting protein fragment? Write the new protein fragment in the table below. If G were added to the original DNA strand after the third base, what would the resulting mRNA look like? How would this addition affect the protein? Show your results in the table below. Data: mRNA from Step 2 Protein Sequence from Step 3 Protein Sequence from Step…
- True or false Both pentose nucleic acid and deoxypentose nucleic acid contain the same pyrimidines Both pentose nucleic acid and deoxypentose nucleic acid and deoxypentose nucleic acid Contain the same purines RNA contains cytosine and thymine DNA and RNA are hydrolysed by weak alkali The anticodon of tRNA finds the complementary codon on mRNA The amino acid is attached to end of tRNA The amino acid is recognized by the anticodon of tRNA A given tRNA can be charged with only one particular amino acidDescribe the requirements and processes involved in protein modelling techniques.Perform a detailed comparison of in silico methods for protein structure prediction.What is their selection criteria? Also, enlist software used for each method (bioinformatics) clarify each and every point with best examples also make it comprehensive. (bioinformatics)Beta ( ? ) sheets are a type of secondary structure in proteins. A segment of a single chain in an antiparallel ? sheet has a length of 80.5 Å . How many residues are in this segment?