How can the composition of nanoparticles be inferred? Briefly describe how to diagnose nanoparticles Explain how nanoparticles are used in medicine and pharmacology
Q: Discuss the principle behind Salkowski test, reaction with ammonium ferrothiocyanate, and…
A: Introduction: Lipids are defined as esters of alcohol and fatty acids which are water-insoluble and…
Q: is bradford assay using dye Coomassie Brilliant Blue G-250 a different method from using a…
A: Protein concentration determination is Pa quantitative estimation that can be done in many ways and…
Q: antispasmodics.
A: A drug is any chemical substance that alters the physiology or psychology of an organism when eaten.…
Q: Name and briefly explain two experimental procedures for determining three dimensional structures of…
A: Proteins exhibit hierarchical structure. Primary structure of the protein is the sequence of amino…
Q: Which of the following tools cannot facilitate the visualization of specific intracellular proteins…
A: Radio isotopes can visualise uptake and downtake but not specific intra cellular proteins. DNA…
Q: How can Biuret test be extended to quantitatively measure the concentration of protein
A: Proteins are the polymers of amino acids.
Q: Agarose gel electrophoresis separates proteins mainly on the basis of what one property? Use BSA vs…
A: Agarose gel electrophoresis is the molecular biology technique used to separate proteins or DNA from…
Q: the FimH crystal structure contains a nickel ion. Predict what might have happened if a…
A: Adhesion can be described as the phenomenon by which bacterial protein, as well as carbohydrates,…
Q: Mass spectrometry is a powerful tool in proteomics. What are the four key features of a mass…
A: The mass spectrometer converts the individual molecules or compounds into ions such that they become…
Q: List 3 advantages and 3 disadvantages of the protein assays Biuret, Folin (Lowry), and Bradford.
A: Protein assays used in determining the protein concentrations. Different protein assay techniques…
Q: how can phosphorylation be detected via 2D gels?
A: 2D gels It refers to the two-dimensional gel electrophoresis. It is generally used to detect and…
Q: Compare and contrast the following protein characterization techniques in terms of the principles…
A: Precipitation happens when the pH or hydrophobicity of a protein affects interactions with the…
Q: 3) Define gel electrophoresis, including its theory and application. Describe the steps of running…
A: Introduction:- Electrophoresis is a biophysical technique mainly used to separate proteins and…
Q: I did an SDS PAGE with BSA as a standard; I noticed in my results that there is a double band - is…
A: SDS-PAGE is Sodium Deodecyl Sulphate Polyacrylamide Gel Electrophoresis. It is a technique that is…
Q: Which of the following is used extensively in biochemical and genetic work ? (a) Agaricus (b)…
A: All the organisms given in the question are different types of fungi. Organisms belonging to the…
Q: List three coating techniques used to make sol-gel coatings, and briefly describe each technique.
A: Sol-gel Is a method of creating solid materials from tiny molecules. The process involves the…
Q: Describe in short the process of size exclusion chromatography (molecular exclusion chromatography)
A: Size exclusion chromatography is a separation of biomolecules techniques where separation was done…
Q: Proteins secreted by bacteria can be used as biomarkers for diagnostics. Give a concise account of…
A: The identification of protein antigens from pathogens can serve as a diagnostic tool. Several…
Q: What types of macromolecules are usually separated on agarose electrophoresis gels?
A: Agarose gel electrophoresis is a method of gel electrophoresis used in biochemistry, molecular…
Q: Monoclonal antibodies can be conjugated to an insoluble support by chemical methods. Explain how…
A: The cloning of immune cells results in the generation of similar immunoglobulins called monoclonal…
Q: Discuss and present the Green Fluorescent Protein?
A: The green fluorescent protein (GFP) is a protein that exhibits bright green fluorescence when…
Q: Pounding is a usual technique used in sample preparation. What is the chemical basis why pounding is…
A: Sample preparation refers to physical processes which allow the sample to be ready of the reaction.…
Q: Explain how a target protein is separated from other cell proteins given a specific purification…
A: Protein purification entails essentially five types of steps: 1) efficient extraction from…
Q: Immunofluorescence and Fluorescent live cell imaging techniques can both be used to determine…
A: Immunofluorescence is a technique in which fluorochrome labeled-antibodies are used to detect the…
Q: For a TLC experiment, what is the purpose of the pentane extraction of spinach juice? Why wouldn’t…
A: Answer: Introduction:Thin layer chromatography, or TLC, is an analytical method to analyse mixtures…
Q: Why do we use a stacking gel in SDS-PAGE
A: SDS-PAGE is a mostly used gel-electrophoresis for separation of proteins. It is used to separate…
Q: Which among the following demonstrates the difference between Native Polyacrylamide Gel…
A: PAGE or polyacrylamide gel electrophoresis is a separation technique under the influence of…
Q: Explain the importance of protein purification and how it can be quantified.
A: Protein is one of the important biomolecules in the cell, which plays several functions in the body.…
Q: What are the benefits and disadvantages of IMAC for purifying proteins?
A: The purification of the proteins is performed by the use of different chromatographic procedures…
Q: polymers are good viscosity enhancers.
A:
Q: You perform a Bradford assay. You obtain the absorbance values listed below from the BSA samples;…
A: Protein quantitation is very important process before processing protein samples for further…
Q: Enumerate and describe at least three (3) big scale pharmaceutical methods on reducing particle…
A: Size reduction is one of the most often utilized and critical unit processes in pharmaceutical…
Q: Write down a detailed explanation of how you would use the Lowry method for protein concentration…
A: Protein can be defined as the macronutrient that is essential or important for building or…
Q: Explain the principle of how electrospray ionization can be used for the analysis of large…
A: Mass spectrometry or MS is an analytical technique for determining the mass-to-charge ratio of ions.…
Q: Why annealing, denaturation temperatures are different? Please answer at your own words.
A: Question: Why annealing, denaturation temperatures are different?
Q: Write down a detailed description about the formation of polyacrylamide gel, how it is used for…
A: Different methods are used for separation of macromolecules. Large size macromolecules are separated…
Q: In this nanotechnology, nanoparticles are used to detect, quantify, and display nanoscale reactions…
A: Nanotechnology It is defined as the science of nanoscale. It involves the utilization of matter on…
Q: How can contaminants in DNA and RNA samples affect absorbance at 260 and concentration results?
A: Introduction: The rings of the bases in nucleic acids (A, T, G, C, and U) are made up of alternating…
Q: present briefly the principle of size exclusion chromatography. give a brief description of the use…
A: Here, the particles are separated on the basis of their size. In this chromatography the column is…
Q: How do we ensure that gel electrophoresis is functional? a Running buffer, containing electrolytes,…
A: Electrophoresis can be described as the process that migration and separation of charged particles…
Q: Explain the advantage of using Fluorescence Recovery After Photobleaching (FRAP) in determining…
A: FRAP or Fluorescence recovery after photo bleaching is a method used to measure the dynamics of…
Q: A number of tests are used to identify a bacterial pathogen taken from human patients.Research and…
A: The detection of particular antibodies in combination with the evaluation of clinical symptoms or…
Q: Explain the difference between native vs denatured PAGE electrophoresis of proteins with respect to…
A:
Q: Draw graphs of optical densities of the amino acid ninhydrin complexes at different wavelengths
A: A sensitive method has been proposed for the quantification of amino acids and proteins using…
Step by step
Solved in 2 steps
- Detergents are synthetic soaplike substances that are used todisrupt membranes and extract membrane proteins. Explainhow this process works.Acid mine drainage is in part a chemical process and in part abiological process. Discuss the chemistry and microbiologythat lead up to acid mine drainage and point out the keyreactions that are biological. What ways can you think of toprevent acid mine drainage? How might you prevent furthergeneration of acid drainage?In what situation(s) would the use of a scanning electron microscope be ideal, and why?
- Liquid supported membrane of DGA used for rare earth elements separation. Tell me the background/introduction of this research, current state of the art, motivation, how these membrane are made , what is the appropriate characteristics of them, approaches that author followed, you can describe the problems of that approaches, why rare earth is challenging to separate, why current state of the art do not address that need, include two or 3 results and describe it. take those information from few journal papers and mention the correct citation.Three dipeptides are separated by electrophoresis at ph 5.8. if the dipeptides are Arg-trp, Asp-thr, and Val-met, describe the motion of each with respect tothe positive and negative electrodes in the electrophoresis apparatus.Biochemistry question pls help explanation needed
- what is the concetration of a lysozyme solution with an absorbance of 0.720 measured at 280 nm( e= 36000 -1M -1cm,l=1cm)46 50 52 60 41 46 55 Find the ff. WITH SOLUTION PLEASE MeanMedianModeSDVarianceCVQuartile 2Decile 7Percentile 25Percentile 30What’s NewActivity 4.1: Answer it brieflyWhy is potential Hydrogen (pH) important to Biology?
- >hypothetical protein [Comamonadaceae bacterium CR] MSLKERIQEEMKAAMRAKDTARLGAIRLLLAAIKQKEVDERVMLDDAAIIAVVDKLIKQRRDSVTAYQQA QRSDLADKEAAEITVLEAYLPQRWSRAEVEEAVSRVVAETAATGPGDMGKVMAAVKAQCQGKADMAVVSQ VVKAALAARGG Using the Lehninger scale, what is the charge of this protein at pH 4.0, pH 7.0, and pH 9.0?Many bacteria are surrounded by a proteoglycan coat. Useyour knowledge of the properties of this substance to suggesta function for such a coat.Some cells lining tubules in the kidneymaintain normal cell volume bysynthesizing organic solutes. Where inthe kidney would you expect to findthese cells? Explain.
