Put these three molecules in the order of most oxidized to least oxidized. нн нс-с-н нн H > > 0= H-C-c H нн нефон H-C-C-ОН OH

Q: You will now build a 15 amino acid peptide using another paper or wire backbone as you did above.…

A: Peptides are polymers of amino acids. Proteins are primarily peptides. There are 20 general…

Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…

A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…

Q: Briefly explain partition coefficients. How is this concept applied in biotechnology?

A: The partition coefficient is defined as the concentration of the solute in the hydrophobic phase…

Q: Calculate the molecular mass of palmitic (hexadecanoic) acid (a fatty acid with formula C₁6H32O2).…

A: Molecular mass is the compound which consists of different atoms.It is calculated by taking the mass…

Q: Which of the following lists the stages of the Calvin cycle in order, starting with the stage where…

A: In the Calvin cycle, carbon atoms from CO2 are incorporated into organic molecules and used to build…

Q: Select the choice that best describes the stereochemistry of the following amino acid, and rank the…

A: Cysteine is one of the 20 standard amino acids that serve as the building blocks of proteins. It is…

Q: Molly is a 10-year-old girl of short stature with hyperelastic skin which bruises easily, and…

A: 1. Amount of Vitamin C in Jane’s diet fails to improve Jane’s symptoms because the dermatosparaxis…

Q: Which of these amino acids is a polar, uncharged amino acid? (Select all that apply, if necessary.)…

A: Amino acids are defined as the organic compounds that have amino (-NH3) and carboxylate (-COO- )…

Q: Refer to the figure below, what are the following forces of attraction is involved in the protein…

A: The tertiary structure of the protein is a 3D structure established and stabilised by the…

Q: The hydrolysis of phosphate bonds provides the chemical energy to drive reactions in the cell. The…

A: Gibbs free energy of hydrolysis of creatine phosphate to creatine isΔG°= -43kJ/molThis implies, its…

Q: II. Give biomolecules found in the animal body, characterize its type, a) organic or inorganic; b)…

A: Biomolecules are organic compounds that are found in living things and are crucial to their…

Q: Explain the chemical structure of ATP. Why is it considered to be a modified nucleotide?

A: Adenosine triphosphate (ATP) is an important molecule and is the source of energy for use, storage…

Q: The peptide KNYPEH N-terminal amino group has a pKa of 8.6 and the C-terminal carboxylate group has…

A: At pH 1, both the N-terminal amino group and the C-terminal carboxylate group will be protonated.The…

Q: PROTEINS 1. What will happen to free tyrosine after being subjected to xanthoproteic analysis (is it…

A: Proteins are large, complex biomolecules composed of multiple peptide-bonded amino acids. Proteins…

Q: Indicate what will happen ( increase, decrease or no effect) a. release of glucagon in the blood to…

A: Hormones can be described as chemical messengers. Hormones are synthesized by glands and…

Q: Why is the net charge 0 for cooh? Shouldn't it be +1?

A: Amino acids are biomolecules that have an amino group, a carboxyl group and a side group that is…

Q: Draw a diagram of the tetrapeptide Asn-Trp-Met-Ala (show all side chains and draw all peptide bonds…

A: Amino acids are the building blocks of proteins. A peptide bond is formed between the carboxy…

Q: Classify the fold of each domain as all a (or mostly a), all b (or mostly b), a/b, or a+b.. 1.…

A: 1.Firmicute collagen-binding protein (1FCB):Fold: All beta (mostly b)Domain classification: all…

Q: How does the puzzle  look when completed?

A: Any change in the nucleotide sequence of DNA is called mutation. Mutations may be introduced…

Q: Find the charge of the peptide KEALYR at pH 7.2. Below is the pKa chart. Provide your answer up to…

A: Before going into the intricate and precise calculation that gives us the charge of the given…

Q: 7. A protein has a molecular mass of 400 kDa when measured by gel filtration. When subjected to gel…

A: As we know that the sodium dodecyl (SDS) sulfate is considered as the denaturing agent, which helps…

Q: Sickle cell anemia patients suffer from a distorted red blood cell shape and an anemic condition as…

A: d. In sickle cell anemia patients, 100% of the hemoglobin assembled contains the mutant β globin,…

Q: The equilibrium constant of a system, K, can be related to the standard free energy change, AG,…

A: Details

Q: It is necessary to purify the enzyme before the characterization process?

A: Amazing biological molecules called enzymes catalyze biochemical reactions in living organisms.…

Q: Identify weak noncovalent interactions of biomolecules in aqueous systems including hydrogen…

A: Understanding the complex weak noncovalent interactions of biomolecules in aqueous systems is…

Q: Find the connection among the words below and choose the letter of th word which is different. O A.…

A: DNA fragment separation is accomplished using the agarose gel electrophoresis technique. It…

Q: An intermediate folding stage seen in protein denaturation or renaturation is called : a) domain  b)…

A: An intermediate folding stage seen in protein denaturation or renaturation is called :and option :a)…

Q: If the half-life for the decomposition of a drug is 4 hours, how long will it take for 225 mg of the…

A: In order to solve this problem, first we need to calculate the decay constant (). The half life…

Q: Determine whether each of the examples or phrases describes an essential amino acid, a nonessential…

A: Amino acids are the building blocks of proteins, which are essential molecules in living organisms.…

Q: Draw the haworth projection of starch (only 2 connected monomers) and cellulose (only 2 connected…

A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula:…

Q: Which of the following classes of biological molecules do we commonly use for energy storage?…

A: Energy storage molecules are substances or molecules found in living things that originate with the…

Q: In an ammonia molecule, one nitrogen atom (atomic number = 7; 1s² 2s²2p³) forms covalent bonds with…

A: Ammonia (NH3) is a colourless gas with a strong odour that is made up of one nitrogen atom coupled…

Q: QUESTION 32 Which pair has similar chemical properties? O ¹H and 22 Na O 12C and 28gi O160 and 32

A: Atoms are the building blocks of matter, and the behavior of atoms in chemical reactions is…

Q: Draw the Ala-Ser-Leu-Asp polypeptide (perspective formula) showing the fully extended backbone…

A: Proteins are folded peptides. Peptides are polymers made up of amino acid residues linked via a…

Q: Each peak on the tandem mass spectrogram represents a product ion with a +1 charge. Use the…

A: Mass spectrometry is an analytical gel-free proteomics method used for identification of proteins,…

Q: Which uncharged amino acids (at pH 7) have the tendency to become positively charged? O Asparagine…

A: Amino acids can exist in a variety of ionization states at different pH. The environment's pH can…

Q: For a particular reaction, AH = -16.1 kJ/mol and AS° = −21.8 J/(mol·K). Assuming these values change…

A: To determine the temperature at which the reaction changes from nonspontaneous to spontaneous in the…

Q: Creatinine, C4H7N3O, is a by-product of muscle metabolism, and creatinine levels in the body are…

A: Let's calculate the mass of creatinine in a 10.0 mL blood sample. The normal level of creatinine in…

Q: Which of these amino acids is a hydrophobic amino acid? (Select all that apply, if necessary.) A. B.…

A:

Q: Draw the structure of lysine,arginine, and Cysteine in the protonation state that would predominate…

A: There are four classes of biological macromolecules. They are proteins, nucleic acids, carbohydrates…

Q: Label the key components of a matrix-assisted laser desorption/ionization time-of-flight, or…

A: Matrix assisted laser desorption ionization-time of flight mass spectrometry (MALD1-TOF) is a…

Q: Using the pka data for lysine, draw the molecular species present at each of the following pH values…

A: Lysine has 3 ionizable groups in it. They are;alpha- carboxyl groupalpha-amino groupside chain basic…

Q: Would the base pair Guanosine and Cytosine be more or less stable at pH 10

A: The stability of a base pair like Guanosine (G) and Cytosine (C) can be influenced by pH, but in the…

Q: This image shows the tertiary structure of a protein segment. Tertiary structure results from…

A: Ionic bond is formed between a positively charged and a negatively charged group. The charged groups…

Q: can you tell what the pKas are from this unknown amino acid based on buffering regions and narrow…

A: pH = If [H+] concentration in a solution is high, the pH will be low and the solution is acidic. If…

Q: Describe the structure and function of the bacterial cell wall, and explain it importance as a…

A: (1)  Structure of bacterial cell wall - The bacterial cell wall is made up of peptidoglycan or…

Q: Please help! Sketch a titration curve of the peptide Ala-Tyr-Gln-Met-Asp-His from pH=0 to 14 up to 5…

A: Titration is used to determine the amount of acid in a solution.Sodium hydroxide or potassium…

Q: Given the data for Chymosin shown below: What are the catalytic constants (i.e. Km and Vmax) for…

A: Km is the catalytic constant which is equal to substrate concentration at half of maximal…

Q: 8. When oxygen binds to the heme group, by how many angstroms does the Fe2+ appear to shift? 9. How…

A: The heme group is a prosthetic group in oxygen-binding protein. Its primary function is to bind…

Q: Draw a diagram of a peptide bond in the cis and trans configurations. Show the contributing…

A: The amino group (NH2) of one amino acid and the carboxyl group (COOH) of another amino acid can join…