Since there are 61 sense codons (excluding stop codons), most cells contain 61 different types of tRNAS (one type of tRNA for each sense codon). O True O False
Q: TRNA has peptidal transferase activity. True False Genetic information stored in mRNA is translated…
A: A ribosome is a biological unit made up of Protein molecules and RNA that functions as the cell's…
Q: Using the codon given for each amino acid (Find the table yourself) write the base sequence of mRNA…
A: Transcription is a process of formation of transcript or RNA from DNA by the process of…
Q: RNA codon table 2nd position G 1st A 3rd position position U Phe Phe Leu Leu Leu Leu C Leu Leu Cys…
A: Three consecutive nitrogen base on mRNA is called genetic code which determine a specific amino…
Q: From this DNA sequence DNA: 3’ TACAGTCTGTAGCGTACATTATCGTGACCGACT 5’, change one base in codon 8 to…
A: The genetic material of the cell, that is, the DNA (deoxyribonucleic acid) comprises various coding…
Q: The following is a strand of mRNA: CAA GUG AAA ACA How many amino acids does the mRNA strand above…
A: The protein synthesis process requires the genetic material in the form of DNA to be transcribed…
Q: If the sequence of amino acids encoded by a strand of DNA is serine-alanine-lysine-leucine, what is…
A:
Q: A certain mRNA strand has the following nucleotide sequence: 5'—AUG—ACG—UAU—AAC—UUU—3' What is the…
A: DNA is the double-stranded molecule that is the genetic material in most animals except for some…
Q: 36. Answer and explain
A: A codon is a three-nucleotide sequence of mRNA that corresponds to a specific amino acid or stop or…
Q: The codon sequence corresponds most closely to the sequence of the strand. MRNA O coding DNA TRNA O…
A: Most cells contain deoxyribonucleic acid (DNA) as their genetic material. Some also have ribonucleic…
Q: Second letter of codon U U UC UA UG U CU CC CA CG First letter of AU AC AA AG codon (5'-end) GU GC…
A: The genetic code may be defined as a collection of principles that living cells use to translate…
Q: segment of a polypeptide chain is Arg-Gly-Ser-Phe-Val-Asp-Arg. It is encoded by the following…
A: For protein synthesis, messenger RNA must be made from one strand of DNA called the template strand.…
Q: Methionine is also known as Select one: a. the start codon b. the stop codon c. isoleucine d.…
A: Methionine is an amino acid that consists of a sulfur atom in its side chain. It is a part of many…
Q: DNA C A T G C U MRNA U UG ERNA ionine Amino Acids is synthesized in translation or transcription?…
A: Transcription is the synthesis of m RNA from a DNA template. The translation is the synthesis of a…
Q: The three-nucleotide codon system can be arranged into ____________ combinations.a. 16b. 20c. 64d.…
A: Ribonucleic acid (RNA) is a nucleic acid found in both the nucleus and cytoplasm. Nucleotides are…
Q: The genetic disorder sickle-cell anemia occurs when the amino acid valine takes the place of…
A: Sickle cell anemia is a type of blood related disorder which is also known known as sickle cell…
Q: How many other codons apart from the one used could encode the last amino acid in this peptide (i.e.…
A: The genetic information of all living organisms (except some viruses) is stored in the cell in the…
Q: If given the following coding strand of DNA, what is the mRNA? What tRNA will be present? (hint -…
A: DNA is a hereditary molecule made up of two polynucleotide chains lies in the nuclues of all…
Q: Which of the following codons is not a termination codon for protein synthesis?a) UUUb) UAGc) UAAd)…
A: UUU is not a termination codon for protein synthesis. Hence option a is the right answer UUU codes…
Q: The triplet code allows many amino acids to be specified by more than one codon. Such a code is said…
A: Introduction Amino acids are the building blocks of proteins. The building blocks of life are amino…
Q: Write the amino acid for the codons below 5'-AUG UUC CAG CUA GAU GAU AUG CUG GUA AUU GGG GAA CGC…
A: Biological macromolecules are those large molecules that are necessary for the survival and growth…
Q: polypeptide peptide bond +amino acid tRNA codon anticodon UCA GCA CGU UGC GU ACG UCA ribosome MRNA
A: Translation is the process of formation of a sequence of amino acids using mRNA as a template. It…
Q: Which amino acid is carried by the tRNA with the anticodon 5'-UCA-3'? None-this is a stop codon. OI.…
A: The process of translation helps in formation of long chains of amino acids ie, polynucleotides. We…
Q: The anticodon loop of one of the t RNA Gly molecules from Escherichia coli is as follows: C--G G--C…
A: tRNA is a specialised RNA molecule that transports the amino acids during translation. A tRNA is…
Q: Second base of codon U A G UCU Phenylalanine UAU UUU UGU Cysteine U Tyrosine tyr y UUC phe F UCC UAC…
A: A) The Adenine (A) is present in the intron or non-coding part of the gene, transcription results in…
Q: An anti-codon is on what kind of molecule? O DNA O TRNA O polypeptide O MRNA
A: An anticodon is a tri-nucleotide sequence which is complementary to the codon sequence present on…
Q: In eukaryotes, transcription and translation take place in the same place. O False O true
A: Based on the cell structure, the prokaryotes and eukaryotes can be distinguished. The prokaryotes…
Q: 5 T G T T A G T C G A A T 3 what is the complimentary dna and complimentary mRNA
A: DNA is genetic material which consists of two types of strands . A ) Template strand B ) Coding…
Q: If DNA segments changes from GCATAG to GCATGG, this is a: MRNA Codon/Amino Acid Chart First Base…
A: The DNA sequence GCATAG will have the mRNA code CGUAUC. When the sequence changed to GCATGG, then…
Q: For a TTT triplet of bases in the template sequence of DNA, the anticodon on the TRNA that binds the…
A: The anticodon is a trinucleotide sequence found on tRNA that controls which amino acid it…
Q: The “start” codon is ____ - ____ - ______
A:
Q: The genetic instructions for the amino acid sequence of a polypeptide chain are written in DNA and…
A: The proteins are composed of amino acids that are connected with each other by peptide bonds and…
Q: Sickle cell anemia occurs due to a point mutation in a gené för changes the amino acid at position 6…
A: Red blood cells are small, round, and convex cells that transport oxygen throughout the body.…
Q: When TRNAS and FRNAS have bases that H-bonds with other bases far apart from each other, the RNA…
A: Answer of this question is given below-
Q: AAG ATA CAG GCT CGG TAA For the DNA sequence shown above, identify the following: a. mRNA codons…
A: Introduction When DNA makes the same copy of itself then it is called replication. Each replicated…
Q: During translation, each tRNA molecule must be activated in order to bind to the correct amino acid…
A: In molecular biology, translation is the cycle wherein ribosomes in the cytoplasm or endoplasmic…
Q: TRUE or FALSE. If false, write the word/s that make(s) the statement incorrect. 1. The Kozak…
A: The Kozak consensus sequence for initiation of translation in vertebrates is (GCC) GCCRCCATGG, where…
Q: he anticodon for the codon GCA is:
A: CENTRAL DOGMA- Replication is the process when DNA replicates itself means it will make copies of…
Q: All mRNAs fold into particular three-dimensional structures that are required for their translation…
A: mRNA is a single stranded RNA molecule, synthesised during the transcription process. This mRNA is…
Q: Order of bases in DNA Order of bases in MRNA Order of basea in tRNA (anticodon) Amino acid coded…
A: DNA molecules are the carriers of genetic information in nucleus of a cell. The DNA undergoes the…
Q: The genetic information contained in DNA consists of a linear sequence of coding units known as…
A: From the given case, it is known that the E. coli DNA has a size of 4.70 X 106 bps. As, it is given…
Q: If the anticodon on the tRNA is 3' GCC 5' , the amino acid added by tRNA synthetase will be? 1. P…
A: The central dogma states that the genetic information will flow from DNA to RNA and then to protein,…
Q: The first MRNA codon to specify an amino acid is always Phe Leu (F) (L) Glu Asp (E) (D) Ser (S) Tyr…
A: A gene is a DNA-based functional heredity unit that delivers instructions for the production of RNA…
Q: When the anticodon on a tRNA is "ICG, all of the following codons except can pair with this…
A: Some tRNA anticodon loops contain inosine (I) which allows recognition of multiple codons through…
Q: Introns in mRNA bind to tRNA at the ribosome true False
A: Introns are responsible for gene expression which lead to protein formation later by mRNA.
Q: the complementary strand the 5'and 3' ends and identify corresponding codon as lled V, H, L, T, P,…
A: DNA is a double-stranded helical genetic material that contains hundreds of genes that code for…
Q: Following the 5-> 3' conversion of writing nucleotide sequence, indicate which of the following MRNA…
A:
Q: 8. Codons are sequences that correspond to specific amino acids or signals during protein…
A: Since you have asked multiple questions, we will solve the first question for you. If you want any…
Q: An amino acid sequence reads:N—Met-Gln-Leu-Arg-Cys—C Write out one possible mRNA sequences with a…
A: The process by which mRNA is translated to the amino acid sequence is termed as translation. It…
Q: The following set of RNA is required the translation process except one, mark the INCORRECT? * O a)…
A: Translation is the process by which the synthesis of protein occur. Cells are the basic unit of…
Q: The mRNA codon of valine is GUC UGG CCA TTG
A: Each codon in mRNA is made up of three nucleotides, and each codon indicates a certain amino acid…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"PLEASE ANSWER WHY? Some substitution mutation result in a malfunctioning protein but others do not. Why is this? Good afternoon, Guidance with this question would be most appriciated. Thank you for your time. Polypeptide sequences are formed from 20 amino acids. What is the probability that a single point mutation in a gene will result in a different polypeptide sequence?
- 13c give the codon sequences of every code on this tRNA with the anti-codon 5AAG3, could pair with including wobble matches1. TRUE OR FALSE a) The genetic code in unambigous that means many codons can code for the same amino acids. b) There are no aminoacyl-tRNAs that will go to the A site of the ribosome when UGA is the codon.Codons The genetic code consists of triplets of nucleotides called codons. Refer to the genetic code chart provided to answer the following questions. What is unique about the codon AUG? 2. What is unique about the codon UGA?
- DUE IN 30 MINUTES. This is multiple choice. No need for explanation, answer only. Thank you! A strand of DNA has the following bases: CACGGCC. If the adenine base was deleted, which amino acids would be coded for? a. valine, proline b. proline, arginine c. glycine, arginine d. glycine, alanine1. TRUE OR FALSE: a) Each tRNA has unique identity elements recognized by its specific enzyme involved in charging it with the correct amino acid. b) There is energy requirement for every amino acid added in a growing polypeptide chain.Which choice best fits the blank? Refer to picture. The ribosome moves along the mRNA strand. In panels b, c, and d, new tRNAs carrying ___________. match up with the codons of the mRNA strand. After each tRNA locks into place, a peptide bond forms between the amino acid the tRNA is carrying and the amino acid already there. This process repeats until the end of the sequence is reached. A. ProteinsB. NucleotidesC. Amino Acids
- 1e) Give the sequence of every codon this tRNA, with the anticodon 5'AGG3', could base pair with (perfect and wobble matches), and name the amino acid coded for by each codon whose sequence you have written.For each mutant, state what change has occurred in the DNA, whether it was a substitution by transition or transversion, sense mutation, nonsense or reading frame change. It must present the codon sequence. Normal nucleotide sequence starting from the third codon: CCC-ACG-GUG-ACG-ACA-CGG-UGG Please show the codon and nucleotide sequence of the mutation.100All tRNA molecules have poly (A) tails at their 3' end. Yesorno