Consider a protein with a beta conformation sequence EAGQVHRGP a) Which residue(s) can be substituted by N without affecting the conformation? b) Which residue(s) can be substituted by D without affecting the conformation? c) Which residue(s) cannot be substituted without affecting the conformation?

Consider a protein with a beta conformation sequence EAGQVHRGP a) Which residue(s) can be substituted by N without affecting the conformation? b) Which residue(s) can be substituted by D without affecting the conformation? c) Which residue(s) cannot be substituted without affecting the conformation?

Biology 2e

2nd Edition

ISBN:9781947172517

Author:Matthew Douglas, Jung Choi, Mary Ann Clark

Publisher:Matthew Douglas, Jung Choi, Mary Ann Clark

Chapter3: Biological Macromolecules

Section: Chapter Questions

Problem 23CTQ: Amino acids have the generic structure seen below, where R represents different carbon-based side...

See similar textbooks

Chemistry

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Similar questions

LLNSAMSRLYSLRSS 1.Assuming this sequnce is enitrely alpha helical what is the hydrogen bond donor to the carbonyl oxygen of Met6? 2.what amino acids in the sequnce above would most likely face the hydrophoic core od a protein? 3. at ph7 which amino acid side chain can form ionic bonds.
Draw the structure of 2 five-mers (draw backbones with side chains shown as R groups) forming a beta sheetwith two anti-parallel beta strands. Indicate the hydrogen bonds present inthissecondary structure.
Biochemistry: what does this picture indicate? what is difference bewteen A, B, and C ? why is it important?
Parallel beta sheets are less stable than antiparallel beta sheets, becasue they have __________ hyrdogen bond. Fill in the blank less or more?
Apamine is a small protein toxin present in the venom of the honeybee. Ithas the sequenceCNCKAPETALCARRCQQH(a) If apamine does not react with iodoacetate (see Tools of Biochemistry5B), then how many disulfide bonds are present?(b) If trypsin cleavage gave two peptides, then where is(are) the S¬Sbond(s)?
Explain the role of hydrophobic exclusion during protein folding (tertiary structure); what type of aminoacids would you find towards the center of the protein? Charged? Polar? Non-polar
Chemistry explain how the change is chemical character that occurs with the missense mutation will influence the tertiary or quaternary structure of the protein (FGFR3). How will the change in shape cause LOF or GOF. be specific! amino acid in missense mutation= S249C serine: polar uncharged, phosphorylated cysteine: nonpolar or polar, disulfide bond
Most proteins denature at high temperatures. A. Are peptide bonds typically broken at high temperatures, yes or no? _________________ B. Does denaturation disrupt the primary structure of a protein, yes or no? __________________ C. Why do proteins denature at high temperatures? D. Is it likely that a denatured protein is able to perform its physiological function, yes or no? Why or why not? Thoughtfully defend your answer.
Proteins treated with proteolytic enzymes hydrolyzed peptide bonds to yield a mixture of amino acids only. Is the statement TRUE OR FALSE?
Predict the protein 3° structure of the following protein sequence. Provide detail from 2° structure principles Nterm – SLDVTFSPGAEITFKWNPGSFNSLKDTIRQVTDK – Cterm
What is amphoterism? Show using chemical equations the amphoteric property of protein.
BIOCHEMISTRY If the protein is more hydrophobic, then adding additional charge is not the best strategy. What are other excipients we might select instead of NaCl to try to interrupt these interactions?