=Suggest, which part of these sequence referred to inner core of theprotein/ outer core (use single letter code to determine the amino acid. 1 letter- 1 amino acid):MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSG1.TA

Hydrophobic: A, C, I, L, M, F, W, V. Neutral: G, H, P, S, T, Y. Hydrophilic: R, N, D, Q, E, K

=Suggest, which part of these sequence referred to inner core of the otein/ outer core (use single letter code to determine the amino acid. 1 letter amino acid): ECDUAMICLI DENIND KLCDLDCOA MDDLMALSRDDIEOWETEDD

=Suggest, which part of these sequence referred to inner core of the otein/ outer core (use single letter code to determine the amino acid. 1 letter amino acid): ECDUAMICLI DENIND KLCDLDCOA MDDLMALSRDDIEOWETEDD

Biology Today and Tomorrow without Physiology (MindTap Course List)

5th Edition

ISBN:9781305117396

Author:Cecie Starr, Christine Evers, Lisa Starr

Publisher:Cecie Starr, Christine Evers, Lisa Starr

Chapter7: Gene Expression And Control

Section: Chapter Questions

Problem 2CT

See similar textbooks

Related questions

Q: Translate the following mRNA nucleotide sequence into an amino acid sequence, starting at the first…

A: The deoxyribonucleic acid (DNA) is the hereditary material that transmits the genetic information…

Q: B. Enumerate all the possible DNA nucleotide base sequence for the amino acids given. 4. Met – Leu –…

A: Proteins are polypeptide sequences that are comprised of amino acids. Amino acids are linked…

Q: Which peptide sequence is most likely to be found within the inner core of a globular protein?…

A: Biochemistry is a branch of science that deals with the study of chemical processes related to the…

Q: Describe how two protein sequences are aligned, and how one can determine whether that alignment is…

A: Sequence alignment is a way of arranging protein sequences to identify regions of similarity that…

Q: Protein: Hemoglobin Circle and underline each codon, amino acid sequence, make a mutation of the 3rd…

A: Here the not cleared the mutation type, are point mutations, frame shift mutation, addition mutation…

Q: If the sequence of mRNA is 5'-AAUCGUACGGAUGCCGAAAUACCCAUUAGGGAUUGCAUAGCGAGCAACGGAC-3', what is the…

A: Protein is the final product of a gene that determine the phenotype of the organism. Protein…

Q: Give the name of the protein using the three letter symbol. Give the name of the protein using the…

A: Proteins are highly complex bio molecule present in all living beings. They are polypeptides of…

Q: Suppose that there is an unknown protein that underwent Edman sequencing method. From N- terminal…

A: Sequencing of proteins is done by treating Proteins with different enzymes that have specificity in…

Q: In the amino acid sequence below, the amino acid residue in red was shown to be essential to the…

A: Peptides or proteins are composed of twenty standard amino acids. These standard amino acids differ…

Q: Show where trypsin and chymotrypsin would cleave the following peptide…

A: Amino acids are joined together by a peptide bond to form a polypeptide chain called protein.…

Q: then translate the resulting mRNA using the gentic code table below. Choose the correct sequence of…

A: The flow of genetic information in cells from DNA to messenger RNA ( mRNA) to protein is identified…

Q: Which peptide would absorb the most UV light at 280nm? (Can you show work because I mainly want to…

A: Aromatic amino acids are relatively non polar. All aromatic amino acids such as tyrosine,…

Q: using, 3’ TGAGGCGCTAGGCCAAGCGGTAAGGATGCATGGTCGTGGTAG , What would be the resultant type of error…

A: The given sequence is 3'TGAGGCGCTAGGCCAAGCGGTAAGGATGCATGGTCGTGGTAG5' The mRNA sequence will be…

Q: If the DNA gene is TAC GGT TTA CAG, which amino acids will be put together?

Q: Given the sequences below select all that may have trouble becoming alpha helices. (Select all that…

A: It is the amino acid sequence of a peptide chain that determine which secondary structure the…

Q: When a protein was denatured and lost its function due to its spatial structures were disrupted.…

A: Denaturation includes the breaking of a considerable weak linkages, or bonds (e.g., hydrogen bonds),…

Q: Match the function with the appropriate protein or sequence:

A: tRNA is a short nucleotide chain with L-shaped structure. A tRNA molecule is required for…

Q: Assume the first nucleotide in the sequence is at the +1 position. Transcribe the DNA sequence into…

A: Deoxyribonucleic acid is the genetic material found within a cell's nucleus. Before cell division,…

Q: The sequence of a peptide is given below. Ala-gly-val-leu-trp-lys-ser-phe-arg-proWhich peptide…

A: Chymotrypsin belongs to a group of enzymes that all use a serine as an active site to cleave peptide…

Q: Give the amino acid sequence with some little explanation please. 5′…

A: Decoding a sequence of bases in mRNA results in the formation of either peptide, polypeptide, or…

Q: HN. `NH NH H2N° A. В. Consider the 3 structures shown. Which of these is (normally) NOT present in…

A: Nucleic acids are the major class of biomolecules that are important for all forms of the organism.…

Q: Translation of mRNA Using the codon chart provided, translate the following messenger RNA sequence…

Q: what is the sequence of peptide 1?

A: A nonpeptide is the a polypeptide containing nine amino acids linked via peptide bonds. The sequence…

Q: Using the genetic code, interpret the following set of nucleotides.…

A: The genetic code is a set of rules that living cells use to convert information found in genetic…

Q: Write the codons for the following amino acids. 1. Phe 2. Val

A: Genetic codon: - It is the 3 nucleotide sequence of DNA and RNA, all bases are involved in formation…

Q: code, indicate which polypeptides would be synthesized if poly-UGG were used in a s G

A: Poly-V indicates valine Poly-G indicates Glycine Ploy-W indicates Tryptophan Poly-Y indicates…

Q: Transcribe the following DNA nucleotide sequence and determine their respective amino acid products.…

A: Transcription Formation of RNA over DNA template is called transcription.

Q: Select the amino acid sequence that would most likely be located in the interior of a water soluble…

A: Peptides are composed of a linear chain of amino acid sequences attached to each other via peptide…

Q: Create protein sequence with 10 amino acids

A: A protein is a polymer of amino acids. Two amino acids are joined together by forming a peptide…

Q: Use Table 1 to read the codons below. Find the name of the amino acid and write it in the space…

A: b) UUA: Leucine c) GAG: Glutamate d) UAU CUA: Tyrosine-Leucine e) AUC UUG: Isoleucine-Leucine

Q: A number of fragments that will be formed by cleaving the peptide Met-Ala-Lys-Met-Arg-Phe-Met-An by…

A: Proteins are one of the macromolecules present in the body. They provide structural support,…

Q: Please write primary amino acid sequence with minimum number of amino acids that leads to formation…

A: The primary amino acid sequence is simply the linear arrangements of amino acids that make up that…

Q: 1. For each of the sequences given below, list what type of secondary structural element, if any is…

A: Proteins are found in four structures namely: Primary which is a linear sequence of amino acids.…

Q: What amino acid sequence is coded for by the mRNA base sequenceCUC-AUU-CCA-UGC-GAC-GUA?

A: The sequence of a protein is notated as a string of letters, according to the order of the amino…

Q: GTTTTCACTGGCGAGCGTCATCTTCCTACT 10. Generate a secondary structure prediction for one identified…

Q: Drew the peptide sequence and write its full name Cys-Gln-Lys-His-Ala-Ser-Gln

A: All the amino acids mentioned in the question are linked Together by peptide bonds that is CONH. A…

Q: Suggest which part of this sequence belongs to the inner part of the protein and which to the outer…

A: Proteins are polypeptides formed of monomeric units-amino acids. There are 20 different amino acids…

Q: с" CH2 CH2 "НaN H с. CH С" CH Нзс CHз ZI о-о

A: The second amino acid in the given dipeptide is glutamate. It contains a negatively charged side…

Q: Draw the peptide formed between asparagine and histidine. H,N-CH-ċ-OH H,N- -CH—С—он CH2 ČH2 N° NH2…

A: Introduction: Proteins are one of the major macromolecules that helps in the structure and function…

Q: Which of the peptide sequences below best matches the hydropathy plot shown? L 10 Residue Number 4 2…

A: Hydrophobicity plot analyzes the amount of the hydrophobicity and the hydrophilicity that is present…

Q: What is the primary amino acid sequence of the peptide depicted? NOTE - Give your answer using…

A: Macromolecules are types of biomolecules that are needed in large amounts for the growth and…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this…

A: Protein or peptides are composed of a linear chain of amino acid sequences attached via peptide…

Q: T-A-C |А - А - G А - т-G G-G-G А -т-т DNA enter answer - enter answer enter answer - enter answer…

A: DNA mRNA TAC AUG AAG UUC ATG UAC GGG CCC ATT UAA

Q: A peptide containing 18 amino acid residues in its sequence was partially hydrolyzed and peptides…

A: Amino acids are biomolecules which contains a basic amine group, an acidic carboxyl group, an…

Q: If the sequence of mRNA is 5'-AAUCGUACGGAUGCCGAAAUACCCAUUAGGGAUUGCAUAGCGAGCAACGGAC-3' , what is the…

A: The genetic code is the set of rules used for translation of the information encoded within genetic…

Q: PLEASE MAKE THE DR BRUJIN GRAPH From these k-mers construct a de Bruijn graph and determine the…

A: In bioinformatics, merging and aligning fragments of a DNA sequence reconstruct the original space.…

Q: In hinge region, what is the most prominent amino acid existing? A B C D E proline G F

A: The antibodies are released from the B-lymphocytes that are performing specific immunological roles…

Q: What is the PRIMARY STRUCTURE (amino acid sequence) of the peptide depicted below? NOTE - PROVIDE…

A: Proteins are polymeric molecules made of repeating amino acid monomers. There are 20 different types…

Q: Spell out the name of the polypeptide using three letter codes for each amino acid separated with…

A: Phenyl isothiocynate is the Edman reagent. It reacts with N-terminal amino acid to give phenyl…

Question

=Suggest, which part of these sequence referred to inner core of the
protein/ outer core (use single letter code to determine the amino acid. 1 letter
- 1 amino acid):
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDP
GPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSG
1.
TA

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

Based on the characteristic given, determine which level of protein structure is being referred to. 3D arrangement of localized regions of proteins A. PRIMARY B. SECONDARY
Which amino acids would you expect to find buried in the interior of peripheral membrane protein ?
What would be shortest time a 250 amino acid protein would be able completely fold to the native conformation? [x] micro seconds
use one-letter code for the amino acid if needed what is the sequence of peptide 1?
Describe the process of denaturation of protein.
Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas, show the amino acid area with the mutation.Lastly, describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
The CFTR membrane protein has an alpha helix that spans the membrane. The amino acid sequence of the central portion of this alpha helix, which is embedded within the membrane, is which one of the sequences below? Sequences are provided in the single letter code. a. VVVEVVVVEVVEEEVE b. VVVLVVVVLVVLLLVL c. VVVLVVVVREERRRER d. EEEREEEEREERRRER
Draw a hydropathy plot and a 2D protein cartoon for a protein that passes through the lipid bilayer 6 times..
If a quaternary (4°) protein structure has six N-terminus. How many total subunits does it have?
Which amino acid sequence will form part of which protein structure, and why? Sequence 1: Ser-Phe-Gln-Val-Lys-Leu-His-Tyr-Asp-Val Sequence 2: Glu-Tyr-Leu-Asn-Phe-Ala-Gln-Val-Leu-Arg __Amphipathic beta strand __ Amphipathic alpha helix
If Kd= 100 nM, [RNA] = 10 nM, and [protein] = 1 uM a) What fraction of RNA is bound? b) What fraction of protein is bound? c) What is the concentration of the protein:RNA complex? d) Is it reasonable to assume that total protein = free protein? e) Is it reasonable to assume that total RNA = free RNA?
Explain protein folding mechanism.