Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWF TEDPGPDEAPRMPEAAPPGVAPTYSA

Q: The following are either a term associated with protein or an example of protein, please…

A: These scrambled words either represent a name of the protein or a term. These terms and names of…

Q: B. Enumerate all the possible DNA nucleotide base sequence for the amino acids given. 4. Met – Leu –…

A: Proteins are polypeptide sequences that are comprised of amino acids. Amino acids are linked…

Q: Explain how tandem mass spectroscopy is used to determinethe sequence of a peptide. Once a peptide…

A: The analytical technique that separates gaseous ions based on mass to charge ratio is mass…

Q: Which peptide sequence is most likely to be found within the inner core of a globular protein?…

A: Biochemistry is a branch of science that deals with the study of chemical processes related to the…

Q: the peptide (written N-terminal to C-terminal) represented by Ala-Ser-Ala-Tyr the same as the…

A: Ans. Yes, the polypeptide chain of amino acid will be Similarly in structure and function whether it…

Q: Protein: Hemoglobin Circle and underline each codon, amino acid sequence, make a mutation of the 3rd…

A: Here the not cleared the mutation type, are point mutations, frame shift mutation, addition mutation…

Q: CH3CO-ETATKAELLAKYEATHK-CONH2 4. A polypeptide comprised of 17 amino acid res- idues with the…

A: Polypeptide: These are chains of amino acids with peptide bonds that connect them. Dehydration of…

Q: If the sequence of mRNA is 5'-AAUCGUACGGAUGCCGAAAUACCCAUUAGGGAUUGCAUAGCGAGCAACGGAC-3', what is the…

A: Protein is the final product of a gene that determine the phenotype of the organism. Protein…

Q: Give the name of the protein using the three letter symbol. Give the name of the protein using the…

A: Proteins are highly complex bio molecule present in all living beings. They are polypeptides of…

Q: Cut the following protein with the Serine Proteolytic enzyme Trypsin. How many peptide fragments are…

A: Protein sequencing is an important aspect in the field of proteomics and molecular biology which…

Q: Suppose that there is an unknown protein that underwent Edman sequencing method. From N- terminal…

A: Sequencing of proteins is done by treating Proteins with different enzymes that have specificity in…

Q: Show where trypsin and chymotrypsin would cleave the following peptide…

A: Amino acids are joined together by a peptide bond to form a polypeptide chain called protein.…

Q: Three polypeptides, the sequences of which are represented using the one-letter code for their amino…

A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…

Q: List possible codon sequences for the following amino acids.(a) Val (b) Phe (c) Asn (d) Gly (e) Met

A: Amino acids are coded by trinucleotides sequence is known as the codon. The first two positions in…

Q: unfold the protein

A: Protein are consist of polymers of amino acids linked by amide/peptide bonds, which is called as…

Q: Given the sequences below select all that may have trouble becoming alpha helices. (Select all that…

A: It is the amino acid sequence of a peptide chain that determine which secondary structure the…

Q: Determine the subunit composition of this protein (i.e., how many subunits are in its quaternary…

A: In electrophoresis separation of molecules is based on mass and charge. The velocity of…

Q: Match the function with the appropriate protein or sequence:

A: tRNA is a short nucleotide chain with L-shaped structure. A tRNA molecule is required for…

Q: Which of the following sequences is most likely to form an unstructured loop in a protein structure?…

A: Proteins are polymers of amino acid sequences. Therefore they are known as polypeptides. There are…

Q: Peptides Drawing and Naming Peptides 1.) Glu-Ser-Ala 2.) Gly-Tyr-Leu-Val

A: The peptides are short chains made of less than 20 amino acids. The proteins are made of more than…

Q: 63. Which of the following statements is CORRECT about protein denaturation? A. Complete protein…

A: The correct option is (b), loss of protein conformation causes loss of protein function.…

Q: Give the amino acid sequence with some little explanation please.   5′…

A: Decoding a sequence of bases in mRNA results in the formation of either peptide, polypeptide, or…

Q: Provide a brief definition for a polymorphic protein

A: Polymorphism means have many types of morphology and structure. It is a condition when more than one…

Q: Ile-Ala-His-Thr-Tyr-Gly-Pro-Phe-Glu-Ala-Ala-Met-Cys-Lys-Trp-Glu-Ala-Gln-Pro-Asp-Gly-Met-Glu-Cys-Ala-…

A: Most common secondary are the α-helix and the β-pleated sheet. Both the secondary structure is…

Q: The folding of some protein was monitored as a function of the time it takes for the protein to…

A: The proteins can be modified by different modifications and this modification can affect the…

Q: Identify a disease or condition related to protein mis-folding.  Which protein is misfolded?  Is…

A: Accumulation of misfolded proteins cause disease various neurodegenerative diseases, such as amyloid…

Q: Transcribe the following DNA nucleotide sequence and determine their respective amino acid products.…

A: Transcription  Formation of RNA over DNA template is called transcription.

Q: Select the amino acid sequence that would most likely be located in the interior of a water soluble…

A: Peptides are composed of a linear chain of amino acid sequences attached to each other via peptide…

Q: Create protein sequence with 10 amino acids

A: A protein is a polymer of amino acids.  Two amino acids are joined together by forming a peptide…

Q: A number of fragments that will be formed by cleaving the peptide Met-Ala-Lys-Met-Arg-Phe-Met-An by…

A: Proteins are one of the macromolecules present in the body. They provide structural support,…

Q: 1. The amino acid sequence for the protein lysozyme is given below. Estimate the isoelectric point…

A: Isoelectric point is the pH where the net charge on a protein is zero.

Q: Draw a peptide from the given amino acids Phe-Cys-Ala-Arg-Ala-Ser-Tyr. Try to cleave this…

A: Pepsin has a broad cleavage specificity but has a greater propensity to cleave near hydrophobic…

Q: Translate the following DNA sequence into amino acids 5'ATAGTACCGCAAATTTATCGCT3' O…

A: Answer :-                             Met-ala-phe-lys-stop                  DNA…

Q: Which amino acid sequence will be generated?  5'-GAAUGUCUUCGUUAUUGAUGUAGAA-3'

A: During translation mRNA is translated into amino acid sequence, by the help of various enzymes, tRNA…

Q: Drew the peptide sequence and write its full name Cys-Gln-Lys-His-Ala-Ser-Gln

A: All the amino acids mentioned in the question are linked Together by peptide bonds that is CONH. A…

Q: Draw the structure of the first 3 nucleotides in the nucleic acid sequence   attaaaggtt tataccttcc…

A: Introduction: A nucleotide consists of a nitrogen base, a pentose sugar, and a phosphate group.

Q: Peptide A: V-E-S-A-L-D-I-F-R-T-A-L-S Peptide B: S-E-P-P-T-E-G-P Peptide C: T-L-S-A-R-I-D-V…

A: Proteins structures are classified as Primary, Secondary, Tertiary, and Quaternary structures.…

Q: The genetic code consists of a series of three-base wordsthat each code for a given amino acid.(a)…

A: The central dogma of molecular biology is the process of the formation of functional products by…

Q: Which one of the following peptides is more likely to aggregate in water solution ? TSCKSSTCCSSKTT…

A: Answer- option B.   GMPILAALGGGPML Isoleucine and phenylalanine amino acid is prese t i this which…

Q: Consider the following protein sequence as an α helix:…

A: The sequence and identity of amino acids of a polypeptide chain make its primary structure.

Q: =Suggest, which part of these sequence referred to inner core of the otein/ outer core (use single…

A: Hydrophobic: A, C, I, L, M, F, W, V. Neutral: G, H, P, S, T, Y. Hydrophilic: R, N, D, Q, E, K

Q: The sequence of the peptide is: a. AINRFILAC b. MGILYRNLG c. MAILYNRLA d. CALIFRNIA e.…

A: Proteins are polymers made of repeating units of amino acids. There are 20 different amino acids…

Q: What is the primary amino acid sequence of the peptide depicted? NOTE - Give your answer using…

A: Macromolecules are types of biomolecules that are needed in large amounts for the growth and…

Q: The following sequence is part of a globular protein. Predict the secondarystructure in this…

A: Protein or peptides are composed of a linear chain of amino acid sequences attached via peptide…

Q: Describe why this position in your protein is important and outline the effects the mutation will…

A: Any change in DNA is referred to as a mutation. Any heritable and genetic modification in the genome…

Q: If the sequence of mRNA is 5'-AAUCGUACGGAUGCCGAAAUACCCAUUAGGGAUUGCAUAGCGAGCAACGGAC-3' , what is the…

A: The genetic code is the set of rules used for translation of the information encoded within genetic…

Q: pu've isolated a novel protein, but you believe what you actually have is mixture of the unmodified…

A: All the techniques described above in the options use one or more criteria to separate the protein…

Q: Spell out the name of the polypeptide using three letter codes for each amino acid separated with…

A: Phenyl isothiocynate is the Edman reagent. It reacts with N-terminal amino acid to give phenyl…