The following sequence is part of a globular protein. Predict the secondary structure in this region. ... RRPVVLMAACLRPVVFITYGDGGTYYHWYH ..
Q: Many of the loops on proteins are composed of hydrophilic amino acids. Why might this be the case?
A: Protein is one of the important biomolecules. This protein is made up of sequence amino acids which…
Q: Even peptides with large nonpolar regions may contain alpha helices stabilized by hydrogen bonding…
A: polypeptides form either alpha helical structure or beta sheets stabilized by hydrogen bond.
Q: Explain how tandem mass spectroscopy is used to determinethe sequence of a peptide. Once a peptide…
A: The analytical technique that separates gaseous ions based on mass to charge ratio is mass…
Q: A monomeric protein contains 154 amino acids. How many codons code for these amino acids? How many…
A: Amino acids are joined by peptide bonds to form a polypeptide. A protien is a polymer of many…
Q: Using protein leptins' primary, secondary, and tertiary structure, explain your understanding on…
A: Major hormones are proteins or peptide hormones, which are mostly water soluble. Leptin is a…
Q: At what level of protein structure (primary, secondary, tertiary or quarternary) does Hydrogen…
A: Protein structures: Proteins are made up of amino acids, different arrangements of the amino acids…
Q: The peptide below NH-CH- HẠN CH- ČH, -NH-CH- NH-CH- NH-CH- OH CH2 CH2 CH2 HN-ç=NH, NH2 CH2 CH HO-CH,…
A: Amino acids are the building blocks of peptides. The net charge on a peptide depends on the sequence…
Q: Most proteins contain more than 100 amino acid residues. If you decided to synthesize a “100-mer,”…
A: Protein is a macronutrient that is essential to building muscle mass.
Q: A particular DNA sequence encodes for MRNA that then encodes for the amino acid glutamate in a…
A: In translation, the newly formed mRNA is decoded in a ribosome. The ribosomes facilitate decoding by…
Q: Remembering that the amino acid side chains projecting from each polypeptide backbone in a β sheet…
A: Amongst secondary structures of polypeptide chains made of amino acids, β-sheets are a more spacious…
Q: In the amino acid sequence below, the amino acid residue in red was shown to be essential to the…
A: Peptides or proteins are composed of twenty standard amino acids. These standard amino acids differ…
Q: Shown below is a portion of primary sequence of a very large protein.…
A: The protein's overall structure contains both alpha helices and beta sheets. The folding and…
Q: Which amino acid sequence is likely to be found on the exterior of a soluble protein?
A: Proteins are polymers of amino acids linked by amide/peptide bonds. Amino acids are consist of amine…
Q: Explain diagrammatically the motifs of protein secondary structure.
A: Protein motifs are small areas of a protein's three-dimensional structure or amino acid sequence…
Q: In sickle cell anemia, a hereditary disease, there is substitution of one amino acid by another in…
A: Sickle cell disease is a blood condition that is most commonly found in the people of African…
Q: Draw out the structural formula of the oligopeptide, with the first amino acid as the N-terminus
A: Amine and carboxylic acid groups in amino acids are joined together, and forms chains of amino acids…
Q: The interactions between the 2 a and 2 b subunits of hemoglobin represent what type of protein…
A: Protein structure: The three dimensional arrangement of monomer units of protein constitute the…
Q: What could be the implications if there is a misfolding in the protein structure?
A: Protein folding is a physical process. In this process, the native polypeptide chain folds into an…
Q: In the Procedure, you were instructed to use your original mixture of phycocyanin and 0.10 M sodium…
A: Phycocyanin: It is a blue color pigment found mainly in cyanobacteria and some algae and is…
Q: If a Cys residue in a protein was replaced with either Ser or Phe amino acid, which substitution…
A: Amino acids Proteins are the polymers of nitrogenous compounds called amino acids. Each amino acid…
Q: For determining the crystal structure, a short sequence of histidine residues is sometimes attached…
A: A polyhistidine tag is an amino acid motif in proteins that typically consists of at least six…
Q: o-H H. Hy-H H. From the N-terminus, this sequence is found on the 125th residue onwards. Based on…
A: Asked : If fragment is found in globular/fibrous protein
Q: Draw out the structural formula of the oligopeptide, with the first amino acid as the N-terminus.
A: 1. Protein primary source is linear sequence of amino acids in peptide or protein. Primary…
Q: The synthesis of a peptide is given by the mRNA sequence 5'GAAGAGAAACUUACU3', Find the primary…
A: The 'Central Dogma' is the process by which the instructions in DNA are converted into a functional…
Q: Which of the following peptides is most likely to form an a-helix? ETAEKAFKQYANDN GLLKQSTQCLEVKT…
A: Most of the alpha-helix are transmembrane proteins
Q: The base sequence of which type of RNA is responsiblefor determining the order of amino acids in a…
A: Translation is the mechanism by which ribosomes in the cytoplasm or endoplasmic reticulum synthesize…
Q: 57. Renaturation may be expected in the denatured proteins of which of the following cases? A.…
A: In molecular biology, renaturation refers to the restoration of a protein or nucleic acid (such as…
Q: Select the amino acid sequence that would most likely be located in the interior of a water soluble…
A: Peptides are composed of a linear chain of amino acid sequences attached to each other via peptide…
Q: What does the sequence of amino acids mean for the hydrophobicity and/or hydrophilicty of the…
A: Proteins are macromolecular compounds composed of amino acids. Twenty distinct amino acids are…
Q: Four of the most abundant amino acids in proteins are leucine, alanine, glycine, and valine. What do…
A: Amino acids are the building blocks of proteins. these are the organic components when proteins are…
Q: A particular amino acid contains a -CH2NH3+ group. Is this amino acid more likely to be found on…
A: In a folded globular protein charged and polar amino acids on the surface of the protein are…
Q: Among these amino acid combinations listed above, only the combination of Lys and Glu have side…
A: The tertiary structure of proteins are stabilized by non covalent interactions like hydrogen…
Q: Describe the planar sections of the primary sequence, their influence on the shape of the protein…
A: Amino acids are the building blocks of proteins. These are compounds containing Carbon, Hydrogen,…
Q: Lys and Arg Glu and Lys Pro and Asp Among these amino acid combinations listed above, only the…
A: Proteins are composed of a linear chain of amino acids attached together via peptide bonds. All…
Q: Suggest which part of this sequence belongs to the inner part of the protein and which to the outer…
A: Proteins are polypeptides formed of monomeric units-amino acids. There are 20 different amino acids…
Q: Can we predict the tertiary structure of a protein if we know its amino acid sequence?
A: The tertiary structure of protein is the three dimensional shape of a protein. The tertiary…
Q: The tertiary structures of the alpha and beta subunits of Hb are examples of which type of…
A: Hemoglobin is defined as the protein molecule present in RBCs carrying oxygen from the lungs to the…
Q: Which R group would most likely be found in a hydrophobic area of the tertiary structure of a…
A: The protein attains a specific conformation for performing mature protein functions in the body.
Q: The term subunit can be used in a variety of ways. What is the difference between a protein subunit…
A: Protein is considered as the building block of the body and it is required for the development of…
Q: The following sequence is part of a globular protein. Predict the secondarystructure in this…
A: Protein or peptides are composed of a linear chain of amino acid sequences attached via peptide…
Q: What is the quarternary structure of the protein leptin?
A: Leptin is a hormone produced mostly by adipocytes and enterocytes in the small intestine. It helps…
Q: Explain the contribution of features of the beta-sheet to the stability of the protein.
A: Proteins are unbranched polymers constructed from 22 standard α-amino acids. They have four levels…
Q: A particular amino acid contains a- CHNH3+ group. Is this amino acid more likely to be found on the…
A: Protein folding is the physical process by which a polypeptide chain is folded into its…
Q: What are intrinsically disordered proteins ? What are their features in terms of amino acid…
A: Proteins are biomolecules composed of amino acids. Amino acids are joined together through peptide…
Q: If a quaternary (4°) protein structure has six N-terminus. How many total subunits does it have?
A: Proteins are the most important macromolrcules in the body. The proteins has definitely structural…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- The following sequence is part of a globular protein. Predict the secondarystructure in this region.cRRPVVLMAACLRPVVFITYGDGGTYYHWYH cA particular amino acid contains a -CH2NH3+ group. Is this amino acid more likely to be found on the inside or outside of the folded protein? Briefly explain.Considering the chemical characteristics of the amino acids valine and glutamic acid (see Figure 5.14), propose a possible explanation for the dramatic effect on protein function that occurs when valine is substituted for glutamic acid.
- Give an example of a protein containing primarily betapleated sheets. Is this a fibrous or globular protein?Give an example of a protein containing primarily alphahelices. Is this a fibrous or globular protein?What is the length in AA’s of the LilP protein? Assume fMet is NOT CLEAVED. Write out the sequence of the polypeptide in AA: use the three letter notation, e.g. Met-Ser-Pro-
- An intermediate folding stage seen in protein denaturation or renaturation is called?What is the expected molecular weight of the protein encoded by the sequence provided here: ATGGCGCACGCTGGGAGAACAGGGTACGATAACCGGGAGATAGTGATGAAGTACATCCATTATAAGCTGTCGCAGAGGGGCTACGAGTGGGATGCGGGAGATGTGGGCGCCGCGCCCCCGGGGGCCGCCCCCGCACCGGGCATCTTCTCCTCCCAGCCCGGGCACACGCCCCATCCAGCCGCATCCCGGGACCCGGTCGCCAGGACCTCGCCGCTGCAGACCCCGGCTGCCCCCGGCGCCGCCGCGGGGCCTGCGCTCAGCCCGGTGCCACCTGTGGTCCACCTGACCCTCCGCCAGGCCGGCGACGACTTCTCCCGCCGCTACCGCCGCGACTTCGCCGAGATGTCCAGCCAGCTGCACCTGACGCCCTTCACCGCGCGGGGACGCTTTGCCACGGTGGTGGAGGAGCTCTTCAGGGACGGGGTGAACTGGGGGAGGATTGTGGCCTTCTTTGAGTTCGGTGGGGTCATGTGTGTGGAGAGCGTCAACCGGGAGATGTCGCCCCTGGTGGACAACATCGCCCTGTGGATGACTGAGTACCTGAACCGGCACCTGCACACCTGGATCCAGGATAACGGAGGCTGGGTAGGTGCACTTGGTGATGTGAGTCTGGGCTGAWhat are relatively small proteins with a preponderance of the basic, positively charged amino acids lysine and arginine?
- What is the resulting polypeptide: _______________________________________________________? What effect does this mutation have on the polypeptide? Make sure to compare to the original polypeptide. Would this mutation allow the protein for perform the intended function? Why or why not?What drives spontaneous folding into the correct tertiary structure for a newly synthesized protein?Drew the peptide sequence and write its full name Cys-Gln-Lys-His-Ala-Ser-Gln