What occurs during transcription? Where in the cell does this take place? Protein Synthesis ActivityNuclear membraneDNAmRNATranscriptionMature MRNALenooAmino acidTransport to cytoplamAmino acidchain (protein)TranslationCodonMRNARibosomeUsing information form the lesson and the diagram above, answer the following questions

Genetic material is nothing but the sequence of nucleic acids which is called as DNA. It contains…

Answered: What occurs during transcription? Where…

Science

Biology

What occurs during transcription? Where in the cell does this take place?

Biochemistry

6th Edition

ISBN:9781305577206

Author:Reginald H. Garrett, Charles M. Grisham

Publisher:Reginald H. Garrett, Charles M. Grisham

Chapter30: Protein Synthesis

Section: Chapter Questions

Problem 11P

See similar textbooks

Related questions

Q: What are the three basic stages of transcription? Describe what happens at each stage.

A: Transcription is process of copying genetic information from one strand of DNA into RNA. It occurs…

Q: How do most transcription factors determine which genes they act upo

A: Protein synthesis through genes occurs in two steps: The DNA sequence present in the gene is…

Q: What molecules and proteins involved in transcription?

A: Transcription is a process by which the genetic information from the DNA is transcribed into the RNA…

Q: In the termination phase of transcription what occurs? What is terminating or stopping

A: * Transcription is the process in which a segment of DNA will be copied into RNA. *This segments of…

Q: How Transcription in Eukaryotes Differs from Bacterial Transcription ?

A: In bacteria , the transcription of all the three types of RNA (mRNA, tRNA and rRNA) is catalysed by…

Q: What is mRNA converted into during the process of translation? Where in the cell does this take…

A: As the name suggests, in the translation, the information contained in the messenger RNA gets…

Q: Define the Transcriptional Control under the concept of DNA ? What are Transcription factors ?

A: Transcription is the first of a few stages of DNA based gene expression in which a specific fragment…

Q: Where Transcriptionally active genes are located ?

A: Genes are the basis of heredity. They are transferred from the preceding generation to the…

Q: What happens during each stage of transcription?

A: Answer: Introduction: Transcription involves sequence of DNA to form an RNA. Transcription is done…

Q: How do chromatin modifications regulate transcription?

A: Chromatin is a complex of protein and DNA, present in eukaryotic cells. Its main function is to pack…

Q: How might nucleosome eviction affect transcription?

A: If the nucleosome is repositioned from its original place. Two possibilities might be seen- 1)The…

Q: In transcription which subunit in bacteria is largely responsible for recognizing the promoter?

A: The process of copying the genetic sequence in DNA into mRNA. Bacterial transcription is the process…

Q: What happens to the rate of transcription when glucocorticoid is present?

A: The major antiinflammatory effects of glucocorticoids appear to be due to interaction of the…

Q: What is the role of the mediator in relation to transcription?

A: Mediator is the multiprotein complex that functions as a transcriptional coactivator in all…

Q: Explain the binding of transcription regulatory proteins to DNA ?

A: Transcriprion regulation is accompanied by gene regulatory proteins which bind with regulatory…

Q: What controls transcription in prokaryotes?

A: The regulation of gene expression in prokaryotic cells occurs at the level of transcription. There…

Q: What is the difference between genetic transcription andtranslation?

A: DNA is the genetic material present in all living things. Central dogma of molecular biology refers…

Q: Illustrate the process of transcription initiation ?

A: Transcription is a process of synthesizing RNA over DNA template. Out of the two DNA strands, one…

Q: How is transcription controlled in prokaryotes?

A: DNA is transcribed to form mRNA via gene transcription. Prokaryotic transcription is less complex…

Q: During transcription, what does messenger RNA do?

A: Transcription is the process of synthesis of RNA from DNA. The genetic information from DNA is…

Q: How do mediators, gene-specific transcription factors (activators/repressors), general transcription…

A: Transcription is the process of transfer of genetic information from DNA to messenger RNA. For…

Q: What determine the RNA Spliceforms of a Gene Are Translated ?

A: The initial RNA that is transcribed from a gene's DNA template must be processed before it becomes a…

Q: What are transcription with example?

A: Deoxyribonucleic acid (DNA) is the hereditary unit of life, which carries the genetic information in…

Q: How is transcription different from translation with respect to location, template and end product?

A: Transcription is an important step in utilising the information from genes present inside the DNA…

Q: What are general transcription factors? When do you expect to find them? What is a cis acting…

A: “Since you have asked multiple question, we will solve the first question for you. If you want any…

Q: What are transcription in eukaryotes?

A: Deoxyribonucleic acid (DNA) is the hereditary unit of life, which carries the genetic information in…

Q: How many are the product(s) of transcription?

A: Chromosome are loop like structure present inside the nucleus of cell that consists of DNA , histone…

Q: What are the steps in Transcription.

A: Gene expression can be defined as the process in which the information present in the DNA is decoded…

Q: What acts in trans to regulate the translation of mRNAs?

A: Messenger RNA (mRNA) is a single stranded RNA, which is complementary to one of the DNA strands.…

Q: Where in the cell does transcription occur?

A: Transcription is the process by which messenger rna is made from DNA. This is also called gene…

Q: What are the Modification of the Transcription factor?

A: Transcription is a process that is responsible for the conversion of the genetic information in…

Q: What is the role of chromatin modification in transcription

A: Chromatin remodeling is dynamic modification of chromatin to allow access of condensed genomic DNA…

Q: Where does the transcription occur? Where does transition occur?

A: The answer given is in correspondence with translation instead for transition. We assume that to be…

Q: Does guanine and cytosine bind during transcription?

A: Transcription is a process of making of mRNA from DNA.

Q: What is control of gene expression by RNA leader-mediated premature termination of transcription?

A: Gene expression is a process by which the genes are turned on to form RNA and proteins.…

Q: In bacteria, what event marks the end of the initiation stage of transcription?

A: Deoxyribonucleic acid (DNA) is the hereditary material that undergoes replication which is vital for…

Q: Explain the process of Transcription?

A: The process by which the information contained in a particular segment of DNA is copied into a…

Q: What is a positive effect of proteasome proteins being associated with transcription?

A: The primary function of the proteasome is to degrade proteins but it may serve some more functions…

Q: What are the structure of process of transcription in bacteria?

A: The study of biology at the molecular level is called molecular biology.

Q: How is transcription different in bacteria and eukaryotes? How is it similar?

A: Transcription is the first of several steps of DNA based gene expression in which a particular…

Q: What percent of the transcription in a human cell makes protein-coding RNA, and what percent of…

A: The human genome consists of both the regions, which code for proteins and then which do not. The…

Q: What are the function of trans acting factors and cis acting elements in gene transcription/…

A: Trans-acting factor means "acting from a different molecule". It can be considered the opposite of…

Q: What are the causes affecting by transcription?

A: The process of copying information present in DNA in the form of RNA is called transcription. The…

Q: How does regulation of transcription in eukaryotes differ from regulation of transcription in…

A: Prokaryotic organisms are single-celled organisms lacking a cell nucleus. Therefore, their DNA…

Concept explainers

Genomics

Genes are responsible for transmitting the characters located on the chromosomes from one individual to another across the generations. Genetics is the study of different genes that are involved in different functions. Genetics is a branch of biology that studies genes, genetic diversity, and heredity in living organisms. The genetic system consists of genetic notations, which is a system of signs and symbols. Genotype refers to the organism's genetic composition, and phenotype refers to the observable property of the organism.

Question

What occurs during transcription? Where in the cell does this take place?

Protein Synthesis Activity
Nuclear membrane
DNA
mRNATranscription
Mature MRNA
Lenoo
Amino acid
Transport to cytoplam
Amino acid
chain (protein)
Translation
Codon
MRNA
Ribosome
Using information form the lesson and the diagram above, answer the following questions

Expert Solution

This question has been solved!

Explore an expertly crafted, step-by-step solution for a thorough understanding of key concepts.

This is a popular solution!

SEE SOLUTION Check out a sample Q&A here

Step 1

VIEW

Step 2

VIEW

Trending now

This is a popular solution!

Step by step

Solved in 2 steps

SEE SOLUTION Check out a sample Q&A here

Knowledge Booster

Learn more about

Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biology and related others by exploring similar questions and additional content below.

Similar questions

Translation of mRNA Using the codon chart provided, translate the following messenger RNA sequence into an amino acid sequence (protein). AUG AAA GGU CAC CCC TAG
The journey of a c f t r protein covering translation at ribosomes etc
Translation work is an essential step for protein synthesis. In order for the protein to be synthesized what must be recognized first in translation? How does this important part in translation have an effect on the rest of the reaction? Please provide a valid argument. Be as detailed as possible.
Give the protein synthesized of the given mRNA sequence. No need to explain. Just give the answer. ACUGAAAUGACCAGAUUUAUGGCCUGAAUGACC
Sequence the following steps in protein synthesis from first to last. Write only the numbers (1-6) on space provided for; ____a. transcription ____b. tRNA amino acid ____c. amino acids separate from tRNA ____d. polypeptide chain assembled ____e. mRNA links to ribosome ____f. stop codon encountered in mRNA
Translation requires energy what step(s)? please explain answer B) 30S ribosome subunit binding C) peptide chain elongation A) amino acid attachment to tRNAs both A and B both A and C
Hi, Could you please comfirm the following question. I have selected option c) because tRNA is the the complimentary pairs of mRNA so I figured the oppside end of the tRNA would be the same as the mRNA. When I have tired to double check my answer, no tutor has selected this answer. Thank you in advance, Like mRNA, tRNA has a ribose sugar, U instead of T, and is single stranded. Unlike mRNA, which remains a long single strand of nucleotides, tRNA folds so that some areas pair up. The resulting structure has an anticodon on one end and a site for an amino acid to attach on the other end. There is base complementarity (A pairs with U and G pairs with C) between an mRNA codon and tRNA anticodon.If the amino acid lysine attaches to a tRNA, which of the following anticodons could be at the opposite end of the tRNA molecule? a. UUU and UUC b. AGA and AGU c. AAA and AAG d. UCU and UCA
Protein: HemoglobinCircle and underline each codon, amino acid sequence, make a mutation of the 3rd codon in the nucleotide sequence and circle the affected areas , show the amino acid area with the mutation.Lasltyly describe the impact on the protein."MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFR"
State if the DNA is written 5' to 3' or 3' to 5' Transcribe the sequence. Include the 5' and 3' Translate the sequence (codon chart included) +1 TAGTCCAAAGGTTTACGTAAATGGGATGTCGAAATTGACTAGATCA
Exploring the nuanced landscape of protein dynamics, could you elaborate on noteworthy post-translational modifications (PTMs)? I'm interested in understanding specific examples of PTMs and gaining insights into their functional mechanisms. This inquiry delves into the intricate aspects of protein modulation within a biological context."
After viewing https://www.youtube.com/watch?v=qIwrhUrvX-k , relate the structure of the three RNA to their function in building of Polypeptide and point out the characteristics of a genetic code and their function in translation. 1. Messenger RNA 2. Transfer RNA 3. Ribosomal RNA
This is a homework question that I have on my Adv. Anatomy & Physiology assignment. How to I got about answering the question? (I do have the Codon table in my textbook) Consider a hypothetical protein that consists of the amino acid sequence arginine, phenylalanine and histidine. From this information, construct (1) the original DNA strand, (2) corresponding mRNA codons and (3) tRNA anticodons used to produce this hypothetical protein. (Only use 1 mRNA codon per amino acid.) In addition, be sure to include start and stop sequences where appropriate.